BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1035 (351 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48795-7|CAA88731.1| 347|Caenorhabditis elegans Hypothetical pr... 26 8.7 U80025-1|AAD32271.1| 1064|Caenorhabditis elegans Hypothetical pr... 26 8.7 >Z48795-7|CAA88731.1| 347|Caenorhabditis elegans Hypothetical protein R05H5.1 protein. Length = 347 Score = 25.8 bits (54), Expect = 8.7 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 119 NSTIQKTSLQGELYKYVVVSNRET-Y*SKLICVQNTFLNS 3 N+TIQ +++ +L KYV+ ++ T Y S LIC+ N+ Sbjct: 2 NNTIQNSTITDDL-KYVMTLDKLTEYLSCLICLPGALCNA 40 >U80025-1|AAD32271.1| 1064|Caenorhabditis elegans Hypothetical protein F02C9.3 protein. Length = 1064 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = +2 Query: 209 YLIIANFI--GNYVIPIILNINVDV 277 YL +A FI +Y+IPI L NVD+ Sbjct: 370 YLYLARFILLFSYIIPISLRTNVDM 394 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,521,160 Number of Sequences: 27780 Number of extensions: 111669 Number of successful extensions: 212 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 212 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 472561672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -