BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1033 (736 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 23 2.6 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.5 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 22 5.9 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 7.8 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 21 7.8 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = -1 Query: 577 ILPALEMNVTEPFDLEHGGDVYGEP 503 ++P + + +DL H D+Y +P Sbjct: 80 LIPKDTITIIHIYDLHHNPDIYPDP 104 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 574 LPALEMNVTEPFDLEHGGDVYGEPCLSFSDIN 479 L L+++ L HGG + CLS+ D++ Sbjct: 371 LSELDLSWNSISSLSHGGQLARFKCLSWLDLS 402 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = -3 Query: 191 SSALFAFIC-SSLIATE 144 +SALFAFIC L++ E Sbjct: 4 TSALFAFICIQGLVSAE 20 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 341 PIYRISKLLYQLLVAASPQIVLSYS 267 P++ I LLY L +P I L+++ Sbjct: 299 PVFVILTLLYSLNSCVNPWIYLAFN 323 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 574 LPALEMNVTEPFDLEHGGDVYGEP 503 LP + +DL H D+Y +P Sbjct: 98 LPKSTITHLHIYDLHHNPDIYPDP 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,171 Number of Sequences: 336 Number of extensions: 2337 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -