BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1033 (736 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81099-1|CAB03187.1| 600|Caenorhabditis elegans Hypothetical pr... 31 0.64 Z48583-2|CAA88471.2| 595|Caenorhabditis elegans Hypothetical pr... 28 7.9 >Z81099-1|CAB03187.1| 600|Caenorhabditis elegans Hypothetical protein K08F9.2 protein. Length = 600 Score = 31.5 bits (68), Expect = 0.64 Identities = 18/59 (30%), Positives = 31/59 (52%) Frame = -1 Query: 535 LEHGGDVYGEPCLSFSDINSFFRMCILSINVCRYSLSANFSLSVSLSWTGVFSSIVAGA 359 +EH ++ +SFSD + + L+ V YS+S +FS++ SWT S ++ A Sbjct: 477 IEHSAEI---TAVSFSDDGEYLAVTDLARKVIPYSVSTDFSVTSPNSWTFHTSKVLTVA 532 >Z48583-2|CAA88471.2| 595|Caenorhabditis elegans Hypothetical protein F54B3.3 protein. Length = 595 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 133 EQSHSVAIREEQIKAKRAEESARKICARQEERVALLEGKLANSQRL*DSTI 285 + +HS A ++Q+ KRAEE QEE + E + ++L TI Sbjct: 121 KHAHSRAEYQDQLARKRAEEELAMKARMQEESLRKQEESVKKQEQLRKQTI 171 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,242,135 Number of Sequences: 27780 Number of extensions: 234232 Number of successful extensions: 911 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -