BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1033 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 27 0.24 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 25 0.74 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.2 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 21 9.1 AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 21 9.1 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 21 9.1 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 21 9.1 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 26.6 bits (56), Expect = 0.24 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +1 Query: 148 VAIREEQIKAKRAEESARKI 207 +A+ +EQ+K+K+ EES RK+ Sbjct: 365 LALDQEQLKSKKLEESMRKL 384 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 25.0 bits (52), Expect = 0.74 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 455 QNTHPEEGIDIGERQAGLPIDVAAV 529 Q HPE ID+ R++ L DV V Sbjct: 367 QTVHPETIIDVSRRRSSLICDVYGV 391 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -3 Query: 206 IFLADSSALFAFICSSLIATECDCSISANF 117 + + S +L F+C IA + CS S+ F Sbjct: 246 VLVNGSWSLPGFVCDFYIAMDVTCSTSSIF 275 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 90 SLNSPGFGTLQPPLGCLQGTAQISNSLL 7 SLNS FG + L QG NS++ Sbjct: 45 SLNSENFGIFKRALMGFQGVRGKKNSII 72 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 90 SLNSPGFGTLQPPLGCLQGTAQISNSLL 7 SLNS FG + L QG NS++ Sbjct: 46 SLNSENFGIFKRALMGFQGVRGKKNSII 73 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 90 SLNSPGFGTLQPPLGCLQGTAQISNSLL 7 SLNS FG + L QG NS++ Sbjct: 45 SLNSENFGIFKRALMGFQGVRGKKNSII 72 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 90 SLNSPGFGTLQPPLGCLQGTAQISNSLL 7 SLNS FG + L QG NS++ Sbjct: 45 SLNSENFGIFKRALMGFQGVRGKKNSII 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,172 Number of Sequences: 438 Number of extensions: 2564 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -