BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1031 (394 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0129 - 12590983-12591315,12591432-12591705,12591816-12593800 27 7.1 12_01_0403 - 3185897-3186931,3187200-3187311,3187425-3187735,318... 26 9.4 >09_03_0129 - 12590983-12591315,12591432-12591705,12591816-12593800 Length = 863 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -2 Query: 198 RFVCN--LASQ*EWHTEXLNN*TSPFRCTIRSLVKL*SLAMNCIK 70 RFV + + S +W T ++ P C +R ++ L +NC K Sbjct: 29 RFVTSPSITSNPDWDTSNADDSVGPASCCVRKIIVSNFLPLNCTK 73 >12_01_0403 - 3185897-3186931,3187200-3187311,3187425-3187735, 3188112-3188324,3188834-3189052 Length = 629 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 38 NHAMPTCQVXALIQFIARLYSFT--NDRIVQRNGLV 139 NH T + LIQ+I R++ N +IV+ +G+V Sbjct: 89 NHTNNTLSMIVLIQYIPRVFLIVSLNSKIVKSSGVV 124 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,834,550 Number of Sequences: 37544 Number of extensions: 109246 Number of successful extensions: 150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -