BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1030 (393 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0523 + 4556309-4556311,4556434-4556515,4557528-4557548,455... 81 3e-16 03_04_0043 + 16747103-16747137,16747237-16747259,16748735-167488... 47 6e-06 07_03_1222 - 24983294-24983356,24983695-24983858,24985209-249852... 35 0.027 05_04_0169 - 18694418-18694453,18694516-18694627,18696095-186962... 30 0.58 01_06_1461 - 37520885-37520965,37521366-37521461,37522160-37522297 30 0.76 05_07_0342 + 29402867-29402906,29403012-29403052,29403146-294032... 29 1.3 07_01_0479 + 3606663-3607448 28 3.1 03_06_0641 - 35232858-35232892,35233066-35233290,35233785-352339... 28 3.1 01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165 28 3.1 08_01_0433 + 3794440-3794948,3795696-3796707 27 4.1 09_05_0016 + 20089545-20089748,20090072-20090263,20090644-200908... 27 5.4 05_04_0033 - 17369134-17369321,17369522-17370355,17370429-17373042 27 5.4 05_05_0303 - 23958989-23960563,23962628-23962864,23963250-239634... 27 7.1 03_02_1018 + 13234436-13234729,13235301-13235423 27 7.1 03_02_0191 - 6270591-6271364,6271458-6272168 27 7.1 01_06_0656 - 30926858-30927040,30927141-30927281,30927373-309274... 27 7.1 01_05_0079 - 17944260-17944462,17944742-17945073,17945663-179456... 27 7.1 10_08_0301 - 16619499-16619675,16619770-16619853,16619932-166200... 26 9.4 08_02_0817 + 21516306-21516584,21517515-21517601,21517705-215178... 26 9.4 >08_01_0523 + 4556309-4556311,4556434-4556515,4557528-4557548, 4557824-4557895,4558259-4558311,4558721-4558807 Length = 105 Score = 81.0 bits (191), Expect = 3e-16 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 7/75 (9%) Frame = +2 Query: 50 RKESILDLSKYLEKSIRVKFAGGREAA-------GILKGYDPLLNLVLDNTTEFLRDPDD 208 RKE++LDL+K+++K ++VK GGR+ + G LKGYD LLNLVLD EF R+ DD Sbjct: 4 RKETVLDLAKFVDKGVQVKLTGGRQVSFYGQSVTGTLKGYDQLLNLVLDEAVEFEREQDD 63 Query: 209 PYKLLDDTRALGLVV 253 P KL TR LGL+V Sbjct: 64 PLKLSGKTRQLGLIV 78 Score = 31.9 bits (69), Expect = 0.19 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 208 PIQTFG*HKSFRSCCFRGTSVVLICPMDGMEAIPNPF 318 P++ G + RGT+V+L+ P DG + I NPF Sbjct: 64 PLKLSGKTRQLGLIVCRGTAVMLVSPTDGTDEIANPF 100 >03_04_0043 + 16747103-16747137,16747237-16747259,16748735-16748856, 16748980-16749042 Length = 80 Score = 46.8 bits (106), Expect = 6e-06 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 68 DLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 DL KY++K +++K R G L+G+D +NLV+DNT E Sbjct: 9 DLKKYMDKKLQIKLNANRVIVGTLRGFDQFMNLVVDNTVE 48 >07_03_1222 - 24983294-24983356,24983695-24983858,24985209-24985231, 24985340-24985374 Length = 94 Score = 34.7 bits (76), Expect = 0.027 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 47 RRKESILDLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 ++ ++++ S L + VK R G L+G+D +NLV+DNT E Sbjct: 16 KKLQTLMVYSFTLFSILPVKLNANRVVIGTLRGFDQFMNLVVDNTVE 62 >05_04_0169 - 18694418-18694453,18694516-18694627,18696095-18696243, 18696980-18697033,18697110-18697222,18697323-18697374 Length = 171 Score = 30.3 bits (65), Expect = 0.58 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 71 LSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEF 190 + + + I V G +E G L G+D +N+VL++ TE+ Sbjct: 84 IDRCIGSKIWVIMKGDKELVGTLCGFDVYVNMVLEDVTEY 123 >01_06_1461 - 37520885-37520965,37521366-37521461,37522160-37522297 Length = 104 Score = 29.9 bits (64), Expect = 0.76 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 65 LDLSKY-LEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFL 193 LDL + L++ I VK RE G L YD LN++L + E + Sbjct: 20 LDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEIV 63 >05_07_0342 + 29402867-29402906,29403012-29403052,29403146-29403220, 29403523-29403648,29404195-29404247,29404385-29404475 Length = 141 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 71 LSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 L +++ I V GR G L+G+D N++LD + E Sbjct: 8 LESLVDQIISVITNDGRNIVGTLRGFDQATNIILDESHE 46 >07_01_0479 + 3606663-3607448 Length = 261 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 77 KYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFLRDP 202 +++ +RV GR+ G +D +NLVL + EF + P Sbjct: 11 QFVNYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLP 52 >03_06_0641 - 35232858-35232892,35233066-35233290,35233785-35233929, 35234295-35234406,35234477-35234535,35234981-35235022, 35235372-35235434,35235636-35235697,35236298-35236451, 35236572-35236651,35237646-35237709,35237791-35237959, 35238002-35238114,35238361-35238507 Length = 489 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/55 (36%), Positives = 25/55 (45%) Frame = +2 Query: 50 RKESILDLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFLRDPDDPY 214 R+E D +KY +R+KF +A LKG D L L D FL D Y Sbjct: 267 RREPTSDPTKYTAADVRIKFMLIMQAIVALKGTDQKLRL-CDICGAFLSVYDKKY 320 >01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165 Length = 648 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 14 GSQVTGDNKEKRRKESILDLSKYLEKSIRVKFAGG 118 G V GD+ +K LDL +L +I ++ AGG Sbjct: 403 GRHVAGDDDDKPTMLGPLDLPSFLSDTISIETAGG 437 >08_01_0433 + 3794440-3794948,3795696-3796707 Length = 506 Score = 27.5 bits (58), Expect = 4.1 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -1 Query: 144 PLRIPAASRPPANFTRMLFSKYLLRSNID 58 P RI S+PP + RM+F+ Y LR NID Sbjct: 152 PRRIKPGSKPPKDLKRMVFN-YTLR-NID 178 >09_05_0016 + 20089545-20089748,20090072-20090263,20090644-20090814, 20090915-20091096,20091189-20091435,20091776-20091908, 20092070-20092599,20092940-20093170 Length = 629 Score = 27.1 bits (57), Expect = 5.4 Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +2 Query: 23 VTGDN-KEKRRKESILDLSKYLEKSIR 100 ++GD+ K+ RK S +DLSK L KS+R Sbjct: 597 LSGDSGKDGSRKSSDVDLSKNLPKSVR 623 >05_04_0033 - 17369134-17369321,17369522-17370355,17370429-17373042 Length = 1211 Score = 27.1 bits (57), Expect = 5.4 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -2 Query: 377 LPYLKIYSYHNNYSYPSWLINGFGIASIPSIGHIKTTDVPRKQQDLKL 234 L +L I Y + +YPSWL+ G + ++ S + + R + KL Sbjct: 776 LEHLSIRGYKST-TYPSWLLEGSQLENLESFALYNCSALERLPSNTKL 822 >05_05_0303 - 23958989-23960563,23962628-23962864,23963250-23963449, 23964088-23964250,23964348-23964554,23964667-23964798 Length = 837 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 146 YDPLLNLVLDNTTEFLRDPDDPYKLLDDTRALGLVVSEVH 265 +DP NL +DN R+P D D+T G S +H Sbjct: 667 FDPDSNLDIDNDKVCKRNPSDILSCSDETEFPGSAPSVLH 706 >03_02_1018 + 13234436-13234729,13235301-13235423 Length = 138 Score = 26.6 bits (56), Expect = 7.1 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -2 Query: 305 IASIPSIGHIKTTDVPRKQQDLKLLCHPKVCMGHQ 201 + + ++GH+ + +DLK CH ++ HQ Sbjct: 87 VHDLDTLGHLTRAAIALDMEDLKDECHKRMLQDHQ 121 >03_02_0191 - 6270591-6271364,6271458-6272168 Length = 494 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 117 PPANFTRMLFSKYLLRSNIDSFLL 46 P + + M+ +KY LRSNI SF L Sbjct: 194 PTPSLSAMIINKYKLRSNIRSFNL 217 >01_06_0656 - 30926858-30927040,30927141-30927281,30927373-30927489, 30927696-30927784,30927870-30928010,30928084-30928171, 30928280-30928342,30928544-30928699,30928778-30928870, 30929095-30929176,30929426-30929493,30929575-30930633 Length = 759 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 152 PLLNLVLDNTTEFLRDPDDPYKLLDDT 232 P L+ ++ ++ ++DPDDP + L DT Sbjct: 474 PQLDQLIKEASKMVQDPDDPSQTLYDT 500 >01_05_0079 - 17944260-17944462,17944742-17945073,17945663-17945691, 17946135-17946208,17946293-17946449,17946653-17946655 Length = 265 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -2 Query: 230 CHPKVCMGHQDLLETP*YCLAQGLEGDHSL*EFPPLHALLRI 105 C K C+ +L P C A+ E ++SL P L A+ I Sbjct: 7 CFGKACLLSSVMLVLPPSCFAEPCEPEYSLPNMPLLFAIAMI 48 >10_08_0301 - 16619499-16619675,16619770-16619853,16619932-16620083, 16620296-16620391,16620473-16620627,16620791-16620856, 16620993-16621062,16621175-16621305,16622121-16622307, 16622410-16622485 Length = 397 Score = 26.2 bits (55), Expect = 9.4 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = -1 Query: 162 FRRGS*PLRIPAASRPPANFTRMLFSK----YLLRSNIDSFLLFSLLSPVTWLPF 10 F RGS L IP A+ P NF+ +L Y + + + +F ++ + W P+ Sbjct: 249 FGRGSKVLGIPTANLPAENFSDVLSEHTSGVYFGWAGLSTRGIFKMVMSIGWNPY 303 >08_02_0817 + 21516306-21516584,21517515-21517601,21517705-21517848, 21517937-21518029,21518156-21518407 Length = 284 Score = 26.2 bits (55), Expect = 9.4 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -1 Query: 144 PLRIPAASRPPANFTRMLFSKYLLRSNIDSF--LLFSLLSPV 25 P R+P PP NFT L+S L + D+ + F+ L P+ Sbjct: 107 PFRVPFTLAPPYNFTTELYSAAALVNVNDAIWSMYFNELLPL 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,362,841 Number of Sequences: 37544 Number of extensions: 177533 Number of successful extensions: 514 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -