BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1030 (393 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 4.0 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 22 9.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 9.2 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 4.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 155 LLNLVLDNTTEFLRDPDDP 211 L L+L+ EFL DP+ P Sbjct: 503 LERLILNRLHEFLEDPESP 521 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 21.8 bits (44), Expect = 9.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -1 Query: 117 PPANFTRMLFSKYLLRSNIDSFLLFSLLSPVTWLPFDF 4 PP + +S YL N D F ++ P +P DF Sbjct: 250 PPYGLPTVAWSSYLDVRNRDDFRQLNVSFPFGPVPDDF 287 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.8 bits (44), Expect = 9.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 32 DNKEKRRKESILDLSKYLEKSIRVKFAGGREAAGILKGYDP 154 D+ + +RK S LS + S + +GG E+ GIL P Sbjct: 1450 DSIQSKRKVS--SLSDRSDNSEPGQISGGEESPGILSDDQP 1488 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 365,238 Number of Sequences: 2352 Number of extensions: 6667 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30784536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -