BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1030 (393 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03870.2 68415.m00349 small nuclear ribonucleoprotein, putati... 94 3e-20 At2g03870.1 68415.m00348 small nuclear ribonucleoprotein, putati... 94 3e-20 At3g11500.1 68416.m01402 small nuclear ribonucleoprotein G, puta... 47 4e-06 At2g23930.1 68415.m02857 small nuclear ribonucleoprotein G, puta... 47 4e-06 At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putati... 36 0.013 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.069 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.069 At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putati... 33 0.091 At1g65700.1 68414.m07457 small nuclear ribonucleoprotein, putati... 31 0.21 At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putati... 31 0.28 At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putati... 31 0.28 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 28 2.6 At3g01490.1 68416.m00073 protein kinase, putative similar to ATM... 28 2.6 At2g17430.1 68415.m02011 seven transmembrane MLO family protein ... 27 6.0 At1g68530.2 68414.m07829 very-long-chain fatty acid condensing e... 27 6.0 At1g68530.1 68414.m07828 very-long-chain fatty acid condensing e... 27 6.0 At4g38190.1 68417.m05391 cellulose synthase family protein simil... 26 7.9 At1g11310.1 68414.m01299 seven transmembrane MLO family protein ... 26 7.9 >At2g03870.2 68415.m00349 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm7 [Homo sapiens] SWISS-PROT:Q9UK45 Length = 99 Score = 94.3 bits (224), Expect = 3e-20 Identities = 41/68 (60%), Positives = 52/68 (76%) Frame = +2 Query: 50 RKESILDLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFLRDPDDPYKLLDD 229 RKE++LDL+K+++K ++VK GGR+ G LKGYD LLNLVLD EF+RD DDP K D Sbjct: 4 RKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFVRDHDDPLKTTDQ 63 Query: 230 TRALGLVV 253 TR LGL+V Sbjct: 64 TRRLGLIV 71 Score = 35.5 bits (78), Expect = 0.013 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 256 RGTSVVLICPMDGMEAIPNPFINQE 330 RGT+V+L+ P DG E I NPF+ E Sbjct: 73 RGTAVMLVSPTDGTEEIANPFVTAE 97 >At2g03870.1 68415.m00348 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm7 [Homo sapiens] SWISS-PROT:Q9UK45 Length = 99 Score = 94.3 bits (224), Expect = 3e-20 Identities = 41/68 (60%), Positives = 52/68 (76%) Frame = +2 Query: 50 RKESILDLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFLRDPDDPYKLLDD 229 RKE++LDL+K+++K ++VK GGR+ G LKGYD LLNLVLD EF+RD DDP K D Sbjct: 4 RKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFVRDHDDPLKTTDQ 63 Query: 230 TRALGLVV 253 TR LGL+V Sbjct: 64 TRRLGLIV 71 Score = 35.5 bits (78), Expect = 0.013 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 256 RGTSVVLICPMDGMEAIPNPFINQE 330 RGT+V+L+ P DG E I NPF+ E Sbjct: 73 RGTAVMLVSPTDGTEEIANPFVTAE 97 >At3g11500.1 68416.m01402 small nuclear ribonucleoprotein G, putative / snRNP-G, putative / Sm protein G, putative similar to SWISS-PROT:Q15357 small nuclear ribonucleoprotein G (snRNP-G, Sm protein G, Sm-G, SmG) [Homo sapiens] Length = 79 Score = 47.2 bits (107), Expect = 4e-06 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 68 DLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 DL KY++K +++K R G L+G+D +NLV+DNT E Sbjct: 9 DLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVE 48 >At2g23930.1 68415.m02857 small nuclear ribonucleoprotein G, putative / snRNP-G, putative / Sm protein G, putative similar to small nuclear ribonucleoprotein G (snRNP-G, Sm protein G, Sm-G, SmG) [Homo sapiens] SWISS-PROT:Q15357 Length = 80 Score = 47.2 bits (107), Expect = 4e-06 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 68 DLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 DL KY++K +++K R G L+G+D +NLV+DNT E Sbjct: 9 DLKKYMDKKLQIKLNANRMVTGTLRGFDQFMNLVVDNTVE 48 >At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm5 [Homo sapiens] SWISS-PROT:Q9Y4Y9 Length = 88 Score = 35.5 bits (78), Expect = 0.013 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +2 Query: 71 LSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEF 190 + + + I V G +E GILKG+D +N+VL++ TE+ Sbjct: 14 IDRCIGSKIWVIMKGDKELVGILKGFDVYVNMVLEDVTEY 53 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.1 bits (72), Expect = 0.069 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = +2 Query: 77 KYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFLRDPDDPYKLL----DDTRALG 244 +++ +RV GR+ G +D +NLVL + EF + P K + +D R LG Sbjct: 11 QFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKINEEREDRRTLG 70 Query: 245 LVV 253 LV+ Sbjct: 71 LVL 73 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.1 bits (72), Expect = 0.069 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = +2 Query: 77 KYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFLRDPDDPYKLL----DDTRALG 244 +++ +RV GR+ G +D +NLVL + EF + P K + +D R LG Sbjct: 11 QFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKINEEREDRRTLG 70 Query: 245 LVV 253 LV+ Sbjct: 71 LVL 73 >At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116 Length = 128 Score = 32.7 bits (71), Expect = 0.091 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 71 LSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 L+ YL+K + V GR+ G+L+ +D N VL+ E Sbjct: 15 LAAYLDKKLLVLLRDGRKLMGLLRSFDQFANAVLEEAYE 53 >At1g65700.1 68414.m07457 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm8 [Homo sapiens] SWISS-PROT:O95777 Length = 98 Score = 31.5 bits (68), Expect = 0.21 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 71 LSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 L +++ I V GR G+LKG+D N++LD + E Sbjct: 7 LETLVDQIISVITNDGRNIVGVLKGFDQATNIILDESHE 45 >At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 31.1 bits (67), Expect = 0.28 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 71 LSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 L+ YL++ + V GR+ G L+ +D N VL+ E Sbjct: 15 LASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 31.1 bits (67), Expect = 0.28 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 71 LSKYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTE 187 L+ YL++ + V GR+ G L+ +D N VL+ E Sbjct: 15 LASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 27.9 bits (59), Expect = 2.6 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 77 KYLEKSIRVKFAGGREAAGILKGYDPLLNLVLDNTTEFLRDP 202 +++ +RV GR+ G +D +NLVL + EF + P Sbjct: 11 QFINYRMRVTIQDGRQLIGKFMAFDRHMNLVLGDCEEFRKLP 52 >At3g01490.1 68416.m00073 protein kinase, putative similar to ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 411 Score = 27.9 bits (59), Expect = 2.6 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +2 Query: 8 SKGSQVTGDNKEKRRKESILDLSKYLEKSIRVKFAGGREAAGILKGYDPLLNLV 169 SK + EK R+E +D SK + KS+ + G GI G D + L+ Sbjct: 84 SKNDIIRSTEVEKSRREWEIDPSKLIIKSVIARGTFGTVHRGIYDGQDVAVKLL 137 >At2g17430.1 68415.m02011 seven transmembrane MLO family protein / MLO-like protein 7 (MLO7) identical to membrane protein Mlo7 [Arabidopsis thaliana] gi|14091584|gb|AAK53800; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 542 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 90 FSKYLLRSNIDSFLLFSLLSPVTWLPF 10 F +Y+ RS D F L +SPV W F Sbjct: 275 FQRYIKRSLEDDFKLVVGISPVLWASF 301 >At1g68530.2 68414.m07829 very-long-chain fatty acid condensing enzyme (CUT1) identical to very-long-chain fatty acid condensing enzyme (CUT1) GB:AF129511 (required for cuticular wax biosynthesis and pollen fertility: Millar,A.A., et al., Plant Cell (1999)) Length = 377 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 117 PPANFTRMLFSKYLLRSNIDSFLL 46 P + + M+ +KY LRSNI SF L Sbjct: 197 PTPSLSAMVINKYKLRSNIKSFNL 220 >At1g68530.1 68414.m07828 very-long-chain fatty acid condensing enzyme (CUT1) identical to very-long-chain fatty acid condensing enzyme (CUT1) GB:AF129511 (required for cuticular wax biosynthesis and pollen fertility: Millar,A.A., et al., Plant Cell (1999)) Length = 497 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 117 PPANFTRMLFSKYLLRSNIDSFLL 46 P + + M+ +KY LRSNI SF L Sbjct: 197 PTPSLSAMVINKYKLRSNIKSFNL 220 >At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays Length = 1111 Score = 26.2 bits (55), Expect = 7.9 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -3 Query: 91 FLQVFAKI*YRFFP--SLFFIISCYLAAF*LF 2 FLQ A + +P SLF I+ C+L AF LF Sbjct: 874 FLQRLAYLNVGIYPFTSLFLILYCFLPAFSLF 905 >At1g11310.1 68414.m01299 seven transmembrane MLO family protein / MLO-like protein 2 (MLO2) idenctical to membrane protein Mlo2 [Arabidopsis thaliana] gi|14091574|gb|AAK53795; similar to Mlo [Hordeum vulgare subsp. vulgare] gi|1877221|emb|CAB06083 SWISS-PROT:P93766 Length = 573 Score = 26.2 bits (55), Expect = 7.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 114 PANFTRMLFSKYLLRSNIDSFLLFSLLSPVTW 19 P N +R F KY+ RS F +SPV W Sbjct: 268 PGNESRFDFRKYIQRSLEKDFKTVVEISPVIW 299 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,712,469 Number of Sequences: 28952 Number of extensions: 146886 Number of successful extensions: 456 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 567552648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -