BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1026 (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 25 1.9 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 24 5.9 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 25.4 bits (53), Expect = 1.9 Identities = 13/57 (22%), Positives = 21/57 (36%) Frame = -1 Query: 439 YLEIHNGLSMVYGIIYSTNNKYFKEFLIIWSAWIIQWIRSESVSEHHAFPVRVELVV 269 Y + + I Y Y LI+ +W+ WI E+ S A + L + Sbjct: 209 YQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTM 265 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.8 bits (49), Expect = 5.9 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 206 GETTSTESRTGRVHFGLVSPDDDEFDAYRKRMMLA 310 G T TES GR LV+ DD R +LA Sbjct: 683 GGATDTESVLGRAIADLVASGDDSRQGEMLRKLLA 717 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 696,583 Number of Sequences: 2352 Number of extensions: 12420 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -