BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1025 (498 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 4.7 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 21 4.7 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 8.1 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.4 bits (43), Expect = 4.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 192 KFTIWKKYHNKKLLQLFQCTKHN*SSIKNIELMML 88 + TI + KKLL TK + I+NI L L Sbjct: 301 ELTILEYKRTKKLLYRIPVTKTDSMLIRNINLFSL 335 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 21.4 bits (43), Expect = 4.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 192 KFTIWKKYHNKKLLQLFQCTKHN*SSIKNIELMML 88 + TI + KKLL TK + I+NI L L Sbjct: 126 ELTILEYKRTKKLLYRIPVTKTDSMLIRNINLFSL 160 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 20.6 bits (41), Expect = 8.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -1 Query: 195 LKFTIWKKYHNKKLLQLFQCTKHN 124 L + IW Y L L+ CT N Sbjct: 241 LTYLIWTIYEMYHLAILWSCTSTN 264 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,910 Number of Sequences: 336 Number of extensions: 1951 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -