BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1025 (498 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81593-3|CAB04741.1| 332|Caenorhabditis elegans Hypothetical pr... 29 2.5 AF068716-4|ABQ13068.1| 128|Caenorhabditis elegans Hypothetical ... 28 3.3 >Z81593-3|CAB04741.1| 332|Caenorhabditis elegans Hypothetical protein T20B3.3 protein. Length = 332 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -1 Query: 414 LVIXIL*TKNLRTYL-PSKLIHYFLTI*KSPLKCK*R*RKEN*K*YLSLINCV 259 L + ++ KNL Y P LIHY + + P K ++E K +++L CV Sbjct: 123 LFVLVMTNKNLHRYATPIYLIHYIIPLIVIPTVIKIPDQEEGKKNFINLFECV 175 >AF068716-4|ABQ13068.1| 128|Caenorhabditis elegans Hypothetical protein F26D11.12 protein. Length = 128 Score = 28.3 bits (60), Expect = 3.3 Identities = 16/70 (22%), Positives = 33/70 (47%) Frame = -1 Query: 228 KRQYCFFPESQLKFTIWKKYHNKKLLQLFQCTKHN*SSIKNIELMMLIPNKSHL*LQREM 49 K+ C S+ + + K L C K + ++ N+E + LI NK+ + ++E+ Sbjct: 26 KKVTCLLENSEKDYLYTDDTNYKHLFD--DCKKEHTIALANLESLKLILNKNSIGQRKEI 83 Query: 48 SRIKRNFGSY 19 +K+ F + Sbjct: 84 DELKQLFNGF 93 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,300,250 Number of Sequences: 27780 Number of extensions: 155551 Number of successful extensions: 203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 202 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -