BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1024X (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 25 2.0 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 2.6 Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. 23 6.1 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 379 KARCCAGPESPEPDLGDSLLHPHHSGTGLR 290 + +C A +SP+ G+ LHP G+ L+ Sbjct: 19 RTKCAACLDSPDGMNGNESLHPRPLGSALK 48 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -1 Query: 240 IATSSSGKLELIRRAAARRTPQSSRAVALDSLIIFSTSVSVASAI 106 + T+SS K+EL+R A S + +D I + ++AI Sbjct: 689 VVTTSSQKIELVREAFEAFGRVSGARLNVDKTIALDVGYTTSNAI 733 >Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. Length = 91 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 342 GSGDSGPAQHRAFNGSGLEGTYKRSHRRAPNR 437 G G G +HR ++GT K + RR R Sbjct: 10 GLGKGGARRHRKVLRDNIQGTTKPAIRRLARR 41 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,699 Number of Sequences: 2352 Number of extensions: 8842 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -