BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1023 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0628 - 25643006-25643123,25643314-25643471,25643559-256436... 57 1e-08 05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969,116... 30 2.3 01_05_0176 - 18957676-18958067,18958139-18958242,18958358-189584... 29 3.0 09_04_0741 - 19852339-19852497,19853185-19853246,19853352-198534... 28 9.1 >11_06_0628 - 25643006-25643123,25643314-25643471,25643559-25643687, 25644378-25644451,25644771-25644798 Length = 168 Score = 57.2 bits (132), Expect = 1e-08 Identities = 29/63 (46%), Positives = 40/63 (63%) Frame = -3 Query: 436 DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDCD 257 DKK + ++K Y+K L AKL+ ++ E FK N+ K +LG+ K+LQFF GESM D Sbjct: 83 DKKQFVTFMKRYIKNLSAKLDA---EKQEEFKKNIEGATKYLLGKLKDLQFFVGESMHDD 139 Query: 256 GWL 248 G L Sbjct: 140 GGL 142 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/53 (39%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -2 Query: 677 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAE 522 M +Y+D++TGDE+ SD++ + ++ +++EV G+ V + D+ I G NPSAE Sbjct: 1 MLVYQDLLTGDELLSDSFPYREIENGILWEVDGKWVVQGAIDVDI-GANPSAE 52 >05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969, 1164082-1164240,1164663-1164797,1165116-1165268, 1165358-1165479,1165599-1166541,1166677-1166728, 1166873-1167963,1168058-1168384,1168479-1168559, 1168649-1168717,1168809-1168937,1169038-1169121, 1169210-1169275 Length = 1321 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -3 Query: 439 GDKKSYTL-YLKDYMKKLV-AKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESM 266 G +K TL L++Y+ +V A L+ +Q+E FK +NKV K L+ F+ + M Sbjct: 1140 GSEKMVTLDNLEEYVSSIVDATLKSGISNQIEAFKAGINKVF-----ALKTLRLFSEDEM 1194 Query: 265 D 263 + Sbjct: 1195 E 1195 >01_05_0176 - 18957676-18958067,18958139-18958242,18958358-18958483, 18959495-18959628,18959757-18959894,18960835-18960964, 18961316-18961357,18964741-18965024 Length = 449 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/40 (32%), Positives = 26/40 (65%) Frame = +2 Query: 167 ISLLLDHV*KTS*LVFAYHQSLYIPSWQPSITIHRLPSKE 286 +S +L+ KT+ +F Y LY+P++ + +HRLP+++ Sbjct: 343 LSFVLEPTPKTARRMF-YGSLLYLPAFMAGLLLHRLPNEQ 381 >09_04_0741 - 19852339-19852497,19853185-19853246,19853352-19853415, 19853561-19853614,19853744-19853890,19854460-19854564, 19854651-19854794,19854987-19855093,19855613-19855712, 19855804-19855833,19856492-19856608,19856705-19856828, 19857143-19857189,19857272-19857400,19857777-19857852, 19858446-19858543,19858630-19858671,19858811-19859044 Length = 612 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 212 FAYHQSLYIPSWQPSITIH-RLPSKELKFLKPAEDV 316 F YH +Y+ SW I H + SK++K + P D+ Sbjct: 264 FLYHGRMYVSSWH--ICFHSNVFSKQIKVMLPLRDI 297 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,635,924 Number of Sequences: 37544 Number of extensions: 401432 Number of successful extensions: 1002 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -