BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1022 (395 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 0.96 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 0.96 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 6.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 6.8 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 20 9.0 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 0.96 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 154 SYLCLPAYKFELTFTPSRTL 213 S LC+P Y + FT S T+ Sbjct: 539 SMLCIPGYMIYIWFTTSGTI 558 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 0.96 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 154 SYLCLPAYKFELTFTPSRTL 213 S LC+P Y + FT S T+ Sbjct: 592 SMLCIPGYMIYIWFTTSGTI 611 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 6.8 Identities = 8/38 (21%), Positives = 20/38 (52%) Frame = -2 Query: 193 KLTQICMQVSIDSFVR*KQYNHQKVKVLIVSATREIRR 80 ++T +C+ +S+ + V K+ +++ + IRR Sbjct: 736 QITTLCVAISLSATVTLVCLYSPKIYIILFQPDKNIRR 773 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 6.8 Identities = 8/38 (21%), Positives = 20/38 (52%) Frame = -2 Query: 193 KLTQICMQVSIDSFVR*KQYNHQKVKVLIVSATREIRR 80 ++T +C+ +S+ + V K+ +++ + IRR Sbjct: 826 QITTLCVAISLSATVTLVCLYSPKIYIILFQPDKNIRR 863 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.2 bits (40), Expect = 9.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 299 ILHIYIFDYHKTP 261 +LHI+ YH TP Sbjct: 3 VLHIHYQHYHITP 15 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,212 Number of Sequences: 438 Number of extensions: 1365 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -