BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1018 (601 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26H5.12 |rpo41||mitochondrial DNA-directed RNA polymerase|Sc... 26 3.7 SPAC222.15 |meu13|SPAC821.01|Tat binding protein 1|Schizosacchar... 25 6.4 SPAC23C4.10 |sec2||guanyl-nucleotide exchange factor Sec2 |Schiz... 25 8.5 SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 25 8.5 >SPAC26H5.12 |rpo41||mitochondrial DNA-directed RNA polymerase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1120 Score = 26.2 bits (55), Expect = 3.7 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 207 LKPLFRNDRSKKLIIEPTSSSTNIYTNQIESMSKTKLFDCLM*CSK 344 L+ +F +R + ++P +T N I S+ T +F + CS+ Sbjct: 972 LQTVFIEERDRTATVQPHKQATAFPPNFIHSLDATHMFMTCLKCSE 1017 >SPAC222.15 |meu13|SPAC821.01|Tat binding protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 25.4 bits (53), Expect = 6.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 260 KLIYEHLHKPNRIYEQNEI 316 KL+YE+L K NR Y ++ Sbjct: 19 KLVYEYLRKTNRPYSATDV 37 >SPAC23C4.10 |sec2||guanyl-nucleotide exchange factor Sec2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 25.0 bits (52), Expect = 8.5 Identities = 20/105 (19%), Positives = 39/105 (37%), Gaps = 1/105 (0%) Frame = +3 Query: 84 INKPHICRPTTANMYCQHAVYISFITLFNFSVESKWSRGD-*LKPLFRNDRSKKLIIEPT 260 I+ PH P+ + M + ++ F FN+ ++ SR + N + + T Sbjct: 300 IHNPHPTHPSASAMNYMNPCFLEFHAFFNYPMKFARSRSAYSTSANYSNTPPRNTVTPST 359 Query: 261 SSSTNIYTNQIESMSKTKLFDCLM*CSKLPSRLLRSFLNKVTRMD 395 + S+ + N S + L + R L + R+D Sbjct: 360 ARSSTLSQNPSSSSNSIPLISRNLRDFSFFKRCLEEDIEPTLRLD 404 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 25.0 bits (52), Expect = 8.5 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 188 VESWRLIKTFISKRSLQEINNRTNKLIYEHLHKPNRIYEQNEII 319 + +W +K + ++ + TN + EHL +RIY+ +E I Sbjct: 140 IRAWAPLKPILLAPAMNTLM-WTNPITQEHLSAISRIYKNSEFI 182 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,144,457 Number of Sequences: 5004 Number of extensions: 41904 Number of successful extensions: 83 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -