BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1016 (394 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11260.1 68417.m01822 phosphatase-related low similarity to p... 36 0.010 At4g02450.1 68417.m00332 glycine-rich protein similar to several... 32 0.16 At1g09040.1 68414.m01008 expressed protein 31 0.37 At4g23570.2 68417.m03396 phosphatase-related low similarity to p... 29 1.1 At4g23570.1 68417.m03395 phosphatase-related low similarity to p... 29 1.1 At1g18670.1 68414.m02330 protein kinase family protein contains ... 28 2.0 At3g08600.1 68416.m00999 expressed protein 28 2.6 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 28 2.6 At4g20960.1 68417.m03035 cytidine/deoxycytidylate deaminase fami... 27 3.4 At3g05760.1 68416.m00647 expressed protein 27 3.4 At5g20310.1 68418.m02417 hypothetical protein 27 6.0 At5g11430.1 68418.m01335 transcription elongation factor-related... 27 6.0 At4g11160.1 68417.m01808 translation initiation factor IF-2, mit... 27 6.0 At1g76900.2 68414.m08950 F-box family protein / tubby family pro... 27 6.0 At1g76900.1 68414.m08949 F-box family protein / tubby family pro... 27 6.0 At3g26750.1 68416.m03346 expressed protein 26 7.9 At2g21480.1 68415.m02556 protein kinase family protein contains ... 26 7.9 >At4g11260.1 68417.m01822 phosphatase-related low similarity to protein phosphatase T [Saccharomyces cerevisiae] GI:897806; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 358 Score = 35.9 bits (79), Expect = 0.010 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +1 Query: 1 GDAAFELDLELRGVINIERSSASMLGTKVEIKLKKGEPGSWSKLDF 138 G+ A+ L L G I E+ +L TKVEI+L K E +W+ L++ Sbjct: 202 GEEAYHLQPRLFGKIIPEKCRFEVLSTKVEIRLAKAEIITWASLEY 247 >At4g02450.1 68417.m00332 glycine-rich protein similar to several proteins containing a tandem repeat region such as Plasmodium falciparum GGM tandem repeat protein (GB:U27807) Length = 241 Score = 31.9 bits (69), Expect = 0.16 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 13 FELDLELRGVINIERSSASMLGTKVEIKLKKGEPGSWSKL 132 +EL LEL +N+E S ++ + ++K EP W+KL Sbjct: 51 YELKLELADKVNVEESKINIGERSIFCIIEKAEPERWNKL 90 >At1g09040.1 68414.m01008 expressed protein Length = 911 Score = 30.7 bits (66), Expect = 0.37 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +1 Query: 25 LELRGVINIE-RSSASMLGTKVEIKLKKGEPGSWSKLDFPRTEPKKVEEKSTVQVNTMED 201 LEL + + RSS++ LGT E+ + + G + D PR + + +T + ME Sbjct: 742 LELPSISGLNNRSSSNDLGTTQELGSSEQQHGQQNNTDGPRRQSTRKRPLTTRALEAMES 801 Query: 202 DSVDLSSVETIT 237 D + +++ T Sbjct: 802 DFLTTKRMKSTT 813 >At4g23570.2 68417.m03396 phosphatase-related low similarity to phosphoprotein phosphatase [Mus musculus] GI:567040; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 350 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 1 GDAAFELDLELRGVINIERSSASMLGTKVEIKLKKGEPGSWSKLD 135 G+ A+ L L G I ++ +L TK+EI L K + +W+ L+ Sbjct: 194 GEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLE 238 >At4g23570.1 68417.m03395 phosphatase-related low similarity to phosphoprotein phosphatase [Mus musculus] GI:567040; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 350 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 1 GDAAFELDLELRGVINIERSSASMLGTKVEIKLKKGEPGSWSKLD 135 G+ A+ L L G I ++ +L TK+EI L K + +W+ L+ Sbjct: 194 GEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLE 238 >At1g18670.1 68414.m02330 protein kinase family protein contains Protein kinases ATP-binding region signature, PROSITE:PS00107 and Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 662 Score = 28.3 bits (60), Expect = 2.0 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 94 KLKKGEPGSWSKLDFPR-TEPKKVEEKSTVQVNTMEDDSVDLSSVETITLNKVNMPSI 264 KL+K G++S + R TE ++ V+ + E +SV + E + L K+N P+I Sbjct: 133 KLEKIGQGTYSSVFRARETETGRIVALKKVRFDNFEPESVRFMAREILILRKLNHPNI 190 >At3g08600.1 68416.m00999 expressed protein Length = 316 Score = 27.9 bits (59), Expect = 2.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 110 NLAHGPSLIFPGLNQKR*KKSQLSRSIRWKTIQS 211 ++A PSL PG+ K+ KKS S S W + S Sbjct: 215 SVASAPSLAPPGIESKKKKKSSDSNSKTWIIVGS 248 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 27.9 bits (59), Expect = 2.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 137 KSSLDHEPGSPFFNFISTLVPNIEAELLSILITPL 33 KS LD E SP+F + T+ + A + ITPL Sbjct: 5 KSKLDEELSSPWFYTVCTMGGMLSAGTTHLAITPL 39 >At4g20960.1 68417.m03035 cytidine/deoxycytidylate deaminase family protein similar to SP|P25539 Riboflavin biosynthesis protein ribD [Includes: Diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) (Riboflavin-specific deaminase); 5-amino-6-(5- phosphoribosylamino)uracil reductase (EC 1.1.1.193) (HTP reductase)] {Escherichia coli}; contains Pfam profile PF00383: Cytidine and deoxycytidylate deaminase zinc-binding region Length = 426 Score = 27.5 bits (58), Expect = 3.4 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 190 TMEDDSVDLSSVETITLNKVNMPSI-GFSLEMQFCDILL 303 ++ + + S VET+ L K+N+ SI + C +LL Sbjct: 318 SVAESGISSSGVETVVLEKINLDSILDYCYNRGLCSVLL 356 >At3g05760.1 68416.m00647 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 3.4 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 43 INIERSSASMLGTKVEIKLKKGEPGSWSKLDFPRTEPKKVEEKSTVQ 183 + +ERSS + + E+ K+ PG++++ D K+ EE+ ++ Sbjct: 115 MRVERSSLEQVQERFEVLKKRKAPGTFTEQDLDERIRKQQEEEEELK 161 >At5g20310.1 68418.m02417 hypothetical protein Length = 394 Score = 26.6 bits (56), Expect = 6.0 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = -3 Query: 323 NISKAFISKMSQNCISREKPILGMLTLFNVIVSTELRSTESSSIVLTWTVDFSSTFFGSV 144 +++KA I +SQNCIS ILG ++ ++ + S V+ W DF + V Sbjct: 100 DVAKALIEYISQNCISTF--ILG--ASLKKSITRLFKADDIPSNVMRWAPDFCTVL---V 152 Query: 143 LGKSSL 126 L K L Sbjct: 153 LSKGRL 158 >At5g11430.1 68418.m01335 transcription elongation factor-related contains weak similarity to transcription elongation factors Length = 871 Score = 26.6 bits (56), Expect = 6.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 94 KLKKGEPGSWSKLDFPRTEPKKVEEKS-TVQVNTMEDDSVDLSSVE 228 K KG P S P +P+K++E + N DD D+S VE Sbjct: 485 KSPKGSPKELSDKSLPEAKPEKIDEVTPEFDANVKVDD--DISRVE 528 >At4g11160.1 68417.m01808 translation initiation factor IF-2, mitochondrial, putative similar to SP|P46198|IF2M_BOVIN Translation initiation factor IF-2, mitochondrial precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus} Length = 743 Score = 26.6 bits (56), Expect = 6.0 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +1 Query: 124 SKLDFPRTEPKKVEEKSTVQVNTMEDDSVDLSSVETITLNKVNMPSIGFSLEMQFCDILL 303 +K D P P+KV+ + T + +ED ++ +VE + + +L +Q D+ L Sbjct: 328 NKCDKPGANPEKVKYQLTSEGIELEDIGGNVQAVEVSAAKSTGLDKLEEALLLQAVDMDL 387 Query: 304 MNALD 318 +D Sbjct: 388 KARVD 392 >At1g76900.2 68414.m08950 F-box family protein / tubby family protein similar to Tubby protein (SP:P50586) {Mus musculus}; similar to Chain A, C-Terminal Domain Of Mouse Brain Tubby Protein (GI:6730158) [Mus musculus]; similar to Tubby related protein 1 (Tubby-like protein 1) (Swiss-Prot:O00294) [Homo sapiens]; similar to phosphodiesterase (GI:467578) [Mus musculus]; contains Pfam profile: PF01167: Tub family; contains Pfam PF00646: F-box domain Length = 455 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 218 LRSTESSSIVLTWTVDFSSTFFGSVLGKSSLDHE 117 + S+ S I ++ DFSS F +LG S D E Sbjct: 300 ITSSSSRKITYDYSNDFSSARFSDILGPLSEDQE 333 >At1g76900.1 68414.m08949 F-box family protein / tubby family protein similar to Tubby protein (SP:P50586) {Mus musculus}; similar to Chain A, C-Terminal Domain Of Mouse Brain Tubby Protein (GI:6730158) [Mus musculus]; similar to Tubby related protein 1 (Tubby-like protein 1) (Swiss-Prot:O00294) [Homo sapiens]; similar to phosphodiesterase (GI:467578) [Mus musculus]; contains Pfam profile: PF01167: Tub family; contains Pfam PF00646: F-box domain Length = 455 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 218 LRSTESSSIVLTWTVDFSSTFFGSVLGKSSLDHE 117 + S+ S I ++ DFSS F +LG S D E Sbjct: 300 ITSSSSRKITYDYSNDFSSARFSDILGPLSEDQE 333 >At3g26750.1 68416.m03346 expressed protein Length = 526 Score = 26.2 bits (55), Expect = 7.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 278 SREKPILGMLTLFNVIVSTELRSTESSSIVLTWTVD 171 S KPI G + LF +ST + ESS + +T++ Sbjct: 371 SNGKPIDGGVRLFKCYISTSSTTGESSDVFRKYTLE 406 >At2g21480.1 68415.m02556 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 871 Score = 26.2 bits (55), Expect = 7.9 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +1 Query: 202 DSVDLSSVETITLNKVNMPSIGFSLEMQFCDILLMNALDILTYYYLS 342 DS + +T N + PS + + + FCDI+ + D+ Y++ Sbjct: 307 DSQTIDPNFNVTWNFPSNPSFHYFIRLHFCDIISKSLNDLYFNVYIN 353 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,738,299 Number of Sequences: 28952 Number of extensions: 151121 Number of successful extensions: 472 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 567552648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -