BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1013 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_26446| Best HMM Match : Ion_trans (HMM E-Value=0.25) 31 1.00 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) 29 4.0 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) 28 7.0 SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) 28 9.3 >SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 31.5 bits (68), Expect = 0.76 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 275 EDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPK-HALFL 403 E+ + V KL D L NKG PH N ++E DPK H LF+ Sbjct: 341 EESVDVTKL-DYYLMNKGYIPHADRLNDTLHHYETDPKYHRLFI 383 >SB_26446| Best HMM Match : Ion_trans (HMM E-Value=0.25) Length = 511 Score = 31.1 bits (67), Expect = 1.00 Identities = 20/73 (27%), Positives = 33/73 (45%) Frame = -3 Query: 635 RDKQSYDEHRRKLNFGSRSNMLQQLNKIYRTDID*S*NNNTIQIAIFSDIIMISSR*TRP 456 RD+ D K+ SN L+++N +T + NNN ++ S + R T Sbjct: 344 RDEFVKDFEEIKVKMDEHSNELEEINDTLKTVLHMLQNNNQEEVRSVSSVTADDLRQTMS 403 Query: 455 SYLTLMRYGTVGL 417 S L++ R +GL Sbjct: 404 SILSIPRQSIMGL 416 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 180 SMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAHL*GP 49 S + +S S SSVC ++H+LS+ R +C S A+ P Sbjct: 430 SYIVCRSISYTSSVCRSVIHRLSANRSKTVCRSIGHTGAYTGAP 473 >SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) Length = 283 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/81 (27%), Positives = 39/81 (48%) Frame = +2 Query: 215 ADDQGREIQEGRRLAKVPNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHA 394 A+ +G EI + + +A +K K++D L ++ TA +YV+ YHE KH+ Sbjct: 175 AEKEGSEIVGYKTFQDMADALEK----KIVDGILIDR-----YTAGSYVRHYHENKLKHS 225 Query: 395 LFL*THNPTQPFHTSLVLNSS 457 L +H V++S+ Sbjct: 226 LISASHVQISGQQIGFVISSN 246 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 188 CSMYADQITADDQGREIQEGRRLAKVPNAEDKLKVEKLIDACLANKG 328 C Y + D + I EG R+ + PN E L + L+ NKG Sbjct: 51 CGFYYTEEQVLDIRKAIPEGTRVNEFPNCEHDLITKPLVSGSEKNKG 97 >SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) Length = 1214 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +3 Query: 180 KKYALCMLIKSQLMTKDGKFKKDVAWLKCLMLK 278 ++ ALC +I+++L+TKDG+ + C L+ Sbjct: 1175 RRNALCEVIENRLVTKDGRSLSQAGRILCYRLR 1207 >SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) Length = 367 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 128 LFISFRLG--ETVGSVFLQVLLLLICEGLSQDNADDEHDK 15 LF++F G E VG F+ L CE D DD+H++ Sbjct: 305 LFLAFNRGYRELVGRAFIYTCCTL-CEIAEDDENDDDHER 343 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,964,649 Number of Sequences: 59808 Number of extensions: 452608 Number of successful extensions: 1244 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -