BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1011 (764 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces p... 27 2.9 SPAC2G11.07c |ptc3||protein phosphatase 2C Ptc3|Schizosaccharomy... 27 2.9 SPBC1105.01 |rrp12|SPBPB7E8.03|rRNA processing protein Rrp12|Sch... 25 9.0 >SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 27.1 bits (57), Expect = 2.9 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +1 Query: 55 PFMKGRAPIRRTLNYLNAGKLVLKDKIKVFSVAYNIT-GQNNVGTKEFCFWYLPQIQYKN 231 PF+ RAP R+T +YL K V KD +A T + +F L Q +++ Sbjct: 4 PFLTFRAPTRKTGDYL-VSKFVKKDNFSSLRLARAYTFSTRSTAVSQFSLLSLSQRSFQS 62 >SPAC2G11.07c |ptc3||protein phosphatase 2C Ptc3|Schizosaccharomyces pombe|chr 1|||Manual Length = 414 Score = 27.1 bits (57), Expect = 2.9 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +1 Query: 121 LKDKIKVFSVAYNITGQNNVGTKEFCFWYLPQIQYKNPDVQ 243 +KD + F+V Y+ G + V ++C LPQI KNPD Q Sbjct: 51 VKDPVDFFAV-YDGHGGDKVA--KWCGSNLPQILEKNPDFQ 88 >SPBC1105.01 |rrp12|SPBPB7E8.03|rRNA processing protein Rrp12|Schizosaccharomyces pombe|chr 2|||Manual Length = 1001 Score = 25.4 bits (53), Expect = 9.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 255 KNLTPSPFIKCYLDDGRKILIDVDNKSKE 341 KN +P I+C L+ ++ L+ N+SKE Sbjct: 102 KNNDDAPTIRCALNCTQEFLLSFSNESKE 130 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,091,566 Number of Sequences: 5004 Number of extensions: 63134 Number of successful extensions: 166 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -