Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1011
         (764 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ697720-1|CAG26913.1|  207|Anopheles gambiae putative odorant-b...    26   1.5  

>AJ697720-1|CAG26913.1|  207|Anopheles gambiae putative
           odorant-binding protein OBPjj10 protein.
          Length = 207

 Score = 25.8 bits (54), Expect = 1.5
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +3

Query: 237 RTNSNFKNLTPSPFIKCYLDDGRKILIDVDNKSKEDILEHLLHTVG 374
           R +  F  L    F+KC+LD  +   ID D   ++D++   L TVG
Sbjct: 110 RLSKEFFGLVMVCFVKCFLD--KAGFIDDDGVIQQDVIREKL-TVG 152


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 778,705
Number of Sequences: 2352
Number of extensions: 14478
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79418373
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)