BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1010 (457 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 33 0.001 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 33 0.001 AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 21 7.2 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 21 7.2 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 33.1 bits (72), Expect = 0.001 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -3 Query: 380 PGPCSRAPSGEMAV--SXPGTLGSWTPRR-*SLCPYARLLHEAKFR 252 PGP S+AP+ + ++ S P +G W PRR S P AR +A R Sbjct: 95 PGPLSQAPASQQSLDASDPDAMGKWCPRREWSSPPDARAASDAARR 140 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 33.1 bits (72), Expect = 0.001 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -3 Query: 380 PGPCSRAPSGEMAV--SXPGTLGSWTPRR-*SLCPYARLLHEAKFR 252 PGP S+AP+ + ++ S P +G W PRR S P AR +A R Sbjct: 251 PGPLSQAPASQQSLDASDPDAMGKWCPRREWSSPPDARAASDAARR 296 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 20.6 bits (41), Expect = 7.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 79 RFYEEFKMKTP*LDSKFAYVL 17 R + FK++ LD K Y+L Sbjct: 1 RMFPAFKVRVSGLDKKSKYIL 21 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 20.6 bits (41), Expect = 7.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 79 RFYEEFKMKTP*LDSKFAYVL 17 R + FK++ LD K Y+L Sbjct: 1 RMFPAFKVRVSGLDKKSKYIL 21 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,018 Number of Sequences: 336 Number of extensions: 1992 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -