BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1009 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50240.1 68418.m06222 protein-L-isoaspartate O-methyltransfer... 30 1.3 At1g16750.1 68414.m02011 expressed protein contains Pfam profile... 28 5.0 >At5g50240.1 68418.m06222 protein-L-isoaspartate O-methyltransferase, putative / PIMT, putative similar to SP|Q42539 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (Protein- beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) {Arabidopsis thaliana}; contains Pfam profile PF01135: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Length = 269 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -3 Query: 212 SIFFYRSLDSSRSLTCTFLFETH*TLYVCSEAILDSEWNIIRRRPKVAAEF 60 ++FF+ + S C LF TH T++ + EWN + R+ + +F Sbjct: 75 ALFFHMEVCSLARNLCFSLFSTHKTIFNMLMVLAIPEWNWLERQERDGGKF 125 >At1g16750.1 68414.m02011 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 529 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 150 NALDIVRLQRSNPGLRMEHHQTSSQGSCRVSL 55 NALD+VRL N LR + H+ + SL Sbjct: 140 NALDLVRLSEKNESLRPKDHKAQPRSKVAKSL 171 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,405,281 Number of Sequences: 28952 Number of extensions: 254173 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -