BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1007 (735 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_26446| Best HMM Match : Ion_trans (HMM E-Value=0.25) 31 0.97 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) 29 3.9 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_3125| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) 28 9.0 SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) 28 9.0 >SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 31.5 bits (68), Expect = 0.73 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 271 EDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPK-HALFL 399 E+ + V KL D L NKG PH N ++E DPK H LF+ Sbjct: 341 EESVDVTKL-DYYLMNKGYIPHADRLNDTLHHYETDPKYHRLFI 383 >SB_26446| Best HMM Match : Ion_trans (HMM E-Value=0.25) Length = 511 Score = 31.1 bits (67), Expect = 0.97 Identities = 20/73 (27%), Positives = 33/73 (45%) Frame = -3 Query: 631 RDKQSYDEHRRKLNFGSRSNMLQQLNKIYRTDID*S*NNNTYKIAIFSDIIMISSR*TRP 452 RD+ D K+ SN L+++N +T + NNN ++ S + R T Sbjct: 344 RDEFVKDFEEIKVKMDEHSNELEEINDTLKTVLHMLQNNNQEEVRSVSSVTADDLRQTMS 403 Query: 451 SYLTLMRYGTVGL 413 S L++ R +GL Sbjct: 404 SILSIPRQSIMGL 416 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 176 SMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAHL*GP 45 S + +S S SSVC ++H+LS+ R +C S A+ P Sbjct: 430 SYIVCRSISYTSSVCRSVIHRLSANRSKTVCRSIGHTGAYTGAP 473 >SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) Length = 1214 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +2 Query: 176 KKYALCMLIKSQLMTKDGKFKKDVALVKCLMLK 274 ++ ALC +I+++L+TKDG+ + C L+ Sbjct: 1175 RRNALCEVIENRLVTKDGRSLSQAGRILCYRLR 1207 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +1 Query: 184 CSMYADQITADDQGREIQEGRRSGKVPNAEDKLKVEKLIDACLANKG 324 C Y + D + I EG R + PN E L + L+ NKG Sbjct: 51 CGFYYTEEQVLDIRKAIPEGTRVNEFPNCEHDLITKPLVSGSEKNKG 97 >SB_3125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1268 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/59 (25%), Positives = 29/59 (49%) Frame = -2 Query: 578 IEYVTTTKQNLSNRYRLKLE**HLQDCNILRYNHDIV*INTSELFNTNEVWNGWVGLCV 402 +EY QN+ RY K+ HL+ C I + ++ S+++N + ++ LC+ Sbjct: 1051 LEYGAKVPQNIRQRYLDKIIDEHLRLCRIEKVAYEKALEEESQIYNRATRRHMYINLCI 1109 >SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) Length = 367 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 124 LFISFRLG--ETVGSVFLQVLLLLICEGLSQDNADDEHDK 11 LF++F G E VG F+ L CE D DD+H++ Sbjct: 305 LFLAFNRGYRELVGRAFIYTCCTL-CEIAEDDENDDDHER 343 >SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) Length = 283 Score = 27.9 bits (59), Expect = 9.0 Identities = 22/81 (27%), Positives = 39/81 (48%) Frame = +1 Query: 211 ADDQGREIQEGRRSGKVPNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHA 390 A+ +G EI + + +A +K K++D L ++ TA +YV+ YHE KH+ Sbjct: 175 AEKEGSEIVGYKTFQDMADALEK----KIVDGILIDR-----YTAGSYVRHYHENKLKHS 225 Query: 391 LFL*THNPTQPFHTSLVLNSS 453 L +H V++S+ Sbjct: 226 LISASHVQISGQQIGFVISSN 246 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,178,765 Number of Sequences: 59808 Number of extensions: 434373 Number of successful extensions: 1201 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -