BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1005 (583 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 25 0.47 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.4 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 21 5.8 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 5.8 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 5.8 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 25.0 bits (52), Expect = 0.47 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 109 NLTQHSIAISIKNKIKPKRV 50 N T H+I S+ N +KPK V Sbjct: 313 NTTNHAIVQSLVNSMKPKEV 332 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -1 Query: 418 YYLQLKYIIFNKTNKRLKTIPVNSKRSDDPTLVQQ 314 Y L + Y +FN N T V DP VQ+ Sbjct: 1016 YLLLVIYSVFNMNNVSWGTREVTVVPKPDPNAVQK 1050 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -1 Query: 418 YYLQLKYIIFNKTNKRLKTIPVNSKRSDDPTLVQQ 314 Y L + Y +FN N T V DP VQ+ Sbjct: 1016 YLLLVIYSVFNMNNVSWGTREVTVVPKPDPNAVQK 1050 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 188 CERQKYNHNRYKDHTGRPSCR 126 CE YN+ +D RPS R Sbjct: 123 CELAMYNYVEMRDLVTRPSYR 143 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 188 CERQKYNHNRYKDHTGRPSCR 126 CE YN+ +D RPS R Sbjct: 356 CELAMYNYVEMRDLVTRPSYR 376 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 188 CERQKYNHNRYKDHTGRPSCR 126 CE YN+ +D RPS R Sbjct: 356 CELAMYNYVEMRDLVTRPSYR 376 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,382 Number of Sequences: 336 Number of extensions: 3067 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -