BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1002 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 25 2.4 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 24 4.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.4 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 24 5.4 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 24 5.4 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 24 5.4 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 9.5 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 9.5 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 25.0 bits (52), Expect = 2.4 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -3 Query: 325 PVCLRVKFSSSNLLP*-MDFPPVPFGW--*SPLLAA*NWG 215 PV + SS +P FP VPFGW +P A +WG Sbjct: 131 PVEPAIGTGSSTAIPSDRQFPAVPFGWPDFNPPCAINDWG 170 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 24.2 bits (50), Expect = 4.1 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 368 WFPVLHHHCQD 400 W+P + HHC D Sbjct: 100 WYPEIKHHCPD 110 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 402 SWLDGRHVVFGNVVEGMEVVKQIETFGSQSGKTSK 506 SWL HV V E +V+ +GS S +T+K Sbjct: 3198 SWLLLAHVAPAAVREVKRIVQNFFGWGSSSSRTTK 3232 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 134 PRRVKTSVPCALARKASVTRAPFSIVSSPISCCKEG 241 P ++K S+P K S T P+S P C G Sbjct: 307 PIKLKLSLPYVEREKCSKTFRPWSFALGPGQMCAGG 342 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 238 GDFTNQTALGESP-STAISLKT 300 GD TN+ A+G SP S + L T Sbjct: 407 GDITNEEAIGASPFSNTVDLLT 428 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 238 GDFTNQTALGESP-STAISLKT 300 GD TN+ A+G SP S + L T Sbjct: 407 GDITNEEAIGASPFSNTVDLLT 428 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 88 HRQQ*RRRILVVETFCRY*QCKQFTK 11 H QQ + ++ FCR +CK+ K Sbjct: 427 HHQQVHNQQRILYCFCRNVECKELEK 452 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 463 LTTSMPSTTFPKTTCLPSSQEVLTV 389 L+ ++ T F + CLP+S+E TV Sbjct: 226 LSETVEFTDFIRPICLPTSEESRTV 250 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 802,803 Number of Sequences: 2352 Number of extensions: 17344 Number of successful extensions: 38 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -