BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1001 (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 24 1.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 2.5 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.8 bits (49), Expect = 1.5 Identities = 15/66 (22%), Positives = 28/66 (42%) Frame = +2 Query: 59 NFYPPFSIKTKMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGF 238 +F P S+ + + + D + K+ V N G N + ++ N W+ RN Sbjct: 463 DFQPRGSVFVRFTHLQNQDFTYKITVNNSGNNRMGTCRIFLAPQFDERGNPWLFRNQKDM 522 Query: 239 AFVEFE 256 F+E + Sbjct: 523 -FIELD 527 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.0 bits (47), Expect = 2.5 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 231 GGFRATHTLRMLPYLENIFSISYLD--ALVPKLPTYTLQ 121 G F+A + L L L N+ S Y D AL P L L+ Sbjct: 206 GAFKAENLLVTLTVLPNVNSTVYYDPRALSPNLEFVVLE 244 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,512 Number of Sequences: 336 Number of extensions: 3369 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -