BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0994 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 38 0.007 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 38 0.009 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 37 0.015 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 37 0.015 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 36 0.026 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 36 0.026 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 36 0.026 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 36 0.035 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 36 0.035 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 36 0.035 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 36 0.035 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 36 0.035 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 36 0.035 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.046 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 35 0.046 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.046 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 35 0.046 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 35 0.061 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.061 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 35 0.061 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.061 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 34 0.080 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 34 0.080 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 34 0.080 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 33 0.14 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 33 0.14 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 33 0.14 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 33 0.14 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 33 0.19 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 33 0.25 SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) 33 0.25 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 33 0.25 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 33 0.25 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 32 0.32 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 31 0.75 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_42547| Best HMM Match : AMP-binding (HMM E-Value=1.1e-05) 31 0.99 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 31 0.99 SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 30 1.3 SB_57034| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 30 1.7 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 30 1.7 SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) 29 2.3 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_1039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 29 3.0 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 29 3.0 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 29 3.0 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) 29 4.0 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 29 4.0 SB_11840| Best HMM Match : DUF858 (HMM E-Value=8.1e-15) 28 5.3 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 28 7.0 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 28 7.0 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 28 7.0 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 28 7.0 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 28 7.0 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 28 7.0 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 27 9.2 SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) 27 9.2 SB_11841| Best HMM Match : Ras (HMM E-Value=0) 27 9.2 SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 352 EVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +V E TC CLE+ +P +L C H FC +C Sbjct: 15 KVREELTCSVCLEQFREPKMLPCFHTFCKEC 45 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = -3 Query: 415 MLWQSVYXAKKHLDQLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +L Q K + K + E+++E +C+ C E ++ L C H FC C Sbjct: 343 LLKQMEVTKKAEEEARKSVVEEMEDEFSCIVCQELFIRATTLTCSHSFCEYC 394 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 36.7 bits (81), Expect = 0.015 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 352 EVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 ++++E TC C+E P +L C H FC C Sbjct: 8 QLEDEVTCAICIEHFTDPRLLPCLHTFCRHC 38 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 36.7 bits (81), Expect = 0.015 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 352 EVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 E+D + C CL++ P L CGH+FC C Sbjct: 64 ELDYQPDCPVCLQQASYPVRLPCGHMFCFLC 94 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 35.9 bits (79), Expect = 0.026 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 358 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 PN V ++ TC CLE+ P VL C H +C C Sbjct: 18 PNNV-SDVTCSLCLEQYQDPRVLACLHTYCRHC 49 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 35.9 bits (79), Expect = 0.026 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 361 IPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 I + E C CLE P VL C H FC++C Sbjct: 6 IEERLQKEVECPICLERFKDPRVLPCLHTFCYEC 39 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 35.9 bits (79), Expect = 0.026 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 334 TCVACLEEILQPCVLQCGHIFCHQC 260 +CV C +L PC L CGH C +C Sbjct: 100 SCVRCCGILLGPCTLPCGHTVCEKC 124 Score = 30.7 bits (66), Expect = 0.99 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = -3 Query: 340 EKTCVACLEEILQPCVLQCGHIFCHQC 260 E C C P CGH+FC C Sbjct: 376 EFECTLCCRLFYNPVTTPCGHVFCRAC 402 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -2 Query: 332 MCCMLGGN-ITTLCSSVWPYILPSMLLGALNSCALCRTPFTKNTVVPL 192 +CC L N +TT C V+ + L C +CR+ T+N V + Sbjct: 381 LCCRLFYNPVTTPCGHVFCRACLNRSLDHRPGCPICRSSLTQNVTVAI 428 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 35.9 bits (79), Expect = 0.026 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E + P VL C H FC C Sbjct: 9 LEDEVTCSICIEHLNDPRVLPCLHSFCRHC 38 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 35.5 bits (78), Expect = 0.035 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 35.5 bits (78), Expect = 0.035 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 35.5 bits (78), Expect = 0.035 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 35.5 bits (78), Expect = 0.035 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 35.5 bits (78), Expect = 0.035 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 8 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 37 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 35.5 bits (78), Expect = 0.035 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 361 IPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 I + E C CLE P VL C H FC++C Sbjct: 6 IVERLQKEVECPICLERFKDPRVLPCLHTFCYEC 39 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 35.5 bits (78), Expect = 0.035 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSLCIEHFNDPRVLPCFHSFCRHC 38 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSLCIEHFNDPRVLPCLHSFCRHC 38 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSLCIEHFNDPRVLPCLHSFCRHC 38 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 129 LEDEVTCSLCIEHFNDPRVLPCLHSFCRHC 158 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 8 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 37 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 34.7 bits (76), Expect = 0.061 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 + +E TC C+E P VL C H FC C Sbjct: 9 LQDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 34.7 bits (76), Expect = 0.061 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 ++ E TC C+E P VL C H FC C Sbjct: 9 LEGEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 34.7 bits (76), Expect = 0.061 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 334 TCVACLEEILQPCVLQCGHIFCHQC 260 TC CL+ +++P VL C H FC C Sbjct: 36 TCPICLQLLVEPVVLPCEHEFCKMC 60 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 34.7 bits (76), Expect = 0.061 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 V+++ C C + P V CGH+FC QC Sbjct: 51 VEDDFKCGICFGVLEDPLVTTCGHVFCSQC 80 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 34.3 bits (75), Expect = 0.080 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCLHC 38 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 34.3 bits (75), Expect = 0.080 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 358 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 P +V ++ TC CLE+ P VL C H +C C Sbjct: 9 PKDV-SDVTCSLCLEQYQDPRVLACLHTYCRHC 40 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 34.3 bits (75), Expect = 0.080 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 358 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 P +V ++ TC CLE+ P VL C H +C C Sbjct: 9 PKDV-SDVTCSLCLEQYQDPRVLACLHTYCRHC 40 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 340 EKTCVACLEEILQP-CVLQCGHIFCHQC 260 E TC CLEE+ +P C+ C H C C Sbjct: 14 ELTCPVCLEELKEPKCLTSCAHNVCKPC 41 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 + +E TC C+E P VL C H FC C Sbjct: 14 LQDEVTCSICIEHFDDPRVLPCLHSFCRHC 43 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 346 DNEKTCVACLEEILQPCVLQCGHIFCHQCC 257 ++ CV C EEI V +C H C++CC Sbjct: 9 ESSNLCVVCCEEIEFSAVGKCDHPVCYKCC 38 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 334 TCVACLEEILQPCVLQCGHIFCHQC 260 TC CLE+ P VL C H +C C Sbjct: 15 TCCLCLEQYQDPRVLACLHTYCRHC 39 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 334 TCVACLEEILQPCVLQCGHIFCHQC 260 TC CLE+ P VL C H +C C Sbjct: 15 TCCLCLEQYQDPRVLACLHTYCRHC 39 >SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 346 DNEKTCVACLEEILQPCVLQCGHIFCHQCC 257 ++ CV C EEI V +C H C++CC Sbjct: 9 ESSNLCVVCCEEIEFSAVGKCDHPVCYKCC 38 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 388 KKHLDQLKEIPNEVDNEKTCVACLEEILQPCVL-QCGHIFCHQC 260 KK K + +++E +C CLE+ L+P L C H C +C Sbjct: 4 KKREKAEKTLSGVINDECSCPVCLEDFLEPKSLPNCAHNVCRKC 47 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 349 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++E C C+E P VL C H FC C Sbjct: 9 LEDEVRCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 358 PNEVDNEK-TCVACLEEILQPCVLQCGHIFCHQC 260 P E D + TC+ CL+ P +L C H +C +C Sbjct: 6 PQEKDEKDVTCLLCLDIFTDPRLLPCLHTYCKKC 39 >SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) Length = 474 Score = 32.7 bits (71), Expect = 0.25 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 343 NEKTCVACLEEILQPCVLQCGHIFCHQCC 257 N+ TC C++ + CGH++C Q C Sbjct: 402 NDLTCQICMDAEVNTAFCPCGHVYCCQTC 430 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 32.7 bits (71), Expect = 0.25 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 373 QLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 Q+ I + + E C C + +P +L+C H FC++C Sbjct: 84 QMASILDSLRQEAECSLCHKTPSEPKILKCFHTFCNEC 121 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 370 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 L+ + V +E C C + L P V CGH+ C +C Sbjct: 5 LEYFDDPVPSEFLCSYCRKVYLHPLVTGCGHVLCTKC 41 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 331 CVACLEEILQPCVLQ-CGHIFCHQC 260 C CLE I P LQ CGH FC C Sbjct: 678 CPICLETITYPETLQGCGHTFCRPC 702 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 32.7 bits (71), Expect = 0.25 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 364 EIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 E PN + C CL+ + CGH+FC C Sbjct: 52 EDPNSANANFECNICLDTARDAVISMCGHLFCWPC 86 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 331 CVACLEEILQPCVLQ-CGHIFCHQC 260 C CLE I P LQ CGH FC C Sbjct: 753 CPICLETITYPETLQGCGHTFCRPC 777 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 32.3 bits (70), Expect = 0.32 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C E + +P +L+C H++C +C Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKC 37 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = -3 Query: 379 LDQLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 ++QL ++ + +E+ C CL+ + P + +C H+FC C Sbjct: 50 INQLLQVLSSGVSEE-CPICLDPLDDPSITRCAHVFCTGC 88 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 31.5 bits (68), Expect = 0.57 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 358 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 P +V ++ TC CL + P VL C H +C C Sbjct: 9 PKDV-SDVTCSLCLGQYQDPRVLACLHTYCRHC 40 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 31.1 bits (67), Expect = 0.75 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C +L+P CGH FC C Sbjct: 330 CKLCFNLLLEPVTSLCGHSFCRDC 353 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 31.1 bits (67), Expect = 0.75 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQCC*AH 248 C AC + +P +L C H FC +C H Sbjct: 16 CRACHKVFTEPKILDCLHTFCQKCLGTH 43 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 31.1 bits (67), Expect = 0.75 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 343 NEKTCVACLEEILQPCVLQCGHIFCHQC 260 +E C CL+E +P L C H C +C Sbjct: 17 DELLCPICLDEFKEPKTLSCMHDLCRKC 44 >SB_42547| Best HMM Match : AMP-binding (HMM E-Value=1.1e-05) Length = 529 Score = 30.7 bits (66), Expect = 0.99 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 190 ISGTTVFFVNGVLHNAQLFSAPSNIDGRIYGHTEEHKVVIFP 315 I +F VN V +N ++ + +DG + G E KVVI P Sbjct: 193 IQPKVMFSVNAVRYNGKIHDHMAKLDGVVQGLPELEKVVIIP 234 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 30.7 bits (66), Expect = 0.99 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C CL E P +L+C H FC +C Sbjct: 20 CPVCLGEYKNPMLLRCYHSFCLRC 43 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 30.7 bits (66), Expect = 0.99 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -3 Query: 361 IPNEVDNEKT-CVACLEEILQPCVLQCGHIF-CHQC 260 IP+ +N+ T CV CLE +L CGH+ C C Sbjct: 527 IPDMDENQGTQCVICLENQRNVVLLNCGHVCSCRTC 562 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 30.7 bits (66), Expect = 0.99 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -3 Query: 355 NEVDNEKTCVACLEEILQPCVLQCGHIFCHQCC*AH 248 NE + C+ C + P V +C H FC C H Sbjct: 237 NEDNLPFACIMCRKTFKNPVVTKCLHYFCEACALQH 272 >SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.7 bits (66), Expect = 0.99 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = -3 Query: 370 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCC 257 L+E +++++ C C++E + ++ CGH+ C + C Sbjct: 133 LQEKLSKLEDGLRCKVCMDEQINAVLIPCGHMVCCEQC 170 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 346 DNEKTCVACLEEILQPCVLQ-CGHIFCHQC 260 ++++ C AC E+ P L CGH++C C Sbjct: 1946 EDQELCPACFCEVDNPYQLATCGHVYCRGC 1975 >SB_57034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +1 Query: 217 NGVLHNAQLFSAPSNIDGRIYGHTEEHKVVIFPPSMQHMSFRYPLHWEFLLIGPN 381 N ++ + + PSN D R++ + K IF PS Q+M + + ++G N Sbjct: 355 NWIVFDCSVTQWPSNTDTRMFPSSSHPKPFIFRPSFQYMYVYSNITEDNFILGSN 409 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 Query: 337 KTCVACLEEILQPCVLQCGHIFCHQC 260 + C C+ P VL C H FC QC Sbjct: 13 EVCPKCMNAYENPKVLPCLHTFCSQC 38 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = -3 Query: 385 KHLDQLKEIPNEVDNEKTCVACLEEILQPCV-LQCGHIFCHQCC*AH*TVVHCAGHHLQR 209 + L L+ + N D+ +C +C + C CG C +C AH V H L R Sbjct: 723 RRLLDLRLLENPQDSSASCGSCDSKSPLVCYCFHCGEFLCTECWSAHKLVKVLKEHRLVR 782 Query: 208 I 206 + Sbjct: 783 V 783 >SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -3 Query: 373 QLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFC 269 Q E P N++ C C+ + + CGH FC Sbjct: 86 QAPEPPRAFSNDRQCPVCITDARFLTMTNCGHEFC 120 >SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) Length = 610 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = -3 Query: 415 MLWQSVYXAKKHLDQLKEIPNEVDNEKTCVACLEEILQPCVLQCGHI 275 +LW+S K+ ++ + E +E +C C++ ++ +L+CGH+ Sbjct: 262 LLWKSRNCEKQKVENVSESLDE-----SCKVCMDNLIDCVLLECGHM 303 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C E + QP C H FC C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLC 183 >SB_1039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +1 Query: 211 FVNGVLHNAQLFSA--PSNIDGRIYGHTEEHKVVIFPPSMQHMSFRYPLHWEFL 366 FV + N L SA P +G + + H VVI ++Q+ F Y W+ L Sbjct: 150 FVQRTISNHFLTSAVNPDRTNGILVAYIRSHMVVIIIQNLQNKYFEYGTLWQCL 203 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C E + QP C H FC C Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLC 57 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C E + QP C H FC C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLC 183 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C E + QP C H FC C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLC 183 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C P + CGH FC C Sbjct: 194 CPLCRRVFKDPVITSCGHTFCQAC 217 >SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) Length = 1071 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 334 TCVACLEEILQPCVLQCGHIFCHQCC 257 TC +C E + P +L C C CC Sbjct: 118 TCPSCKETMNDPVLLPCLDSICRSCC 143 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 370 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 +++ +VD C C E + + + CGH FC C Sbjct: 5 VQQFIEKVDPNLLCGICAEVLERAVLTPCGHSFCGVC 41 >SB_11840| Best HMM Match : DUF858 (HMM E-Value=8.1e-15) Length = 257 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 143 KIVYCFLYCTYKLHIFASYGFING-YG 66 ++ CFL C Y LH+ + +++G YG Sbjct: 4 RLAMCFLMCAYLLHVTGTVYYVDGVYG 30 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 334 TCVACLEEILQPCVLQCGHIFCHQCC 257 TC +C E + P +L C C CC Sbjct: 26 TCPSCKETMNGPVLLPCLDSICRSCC 51 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = -3 Query: 370 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 260 L + ++D C C+ + CGH FC C Sbjct: 5 LNKFVGKIDQNLLCNICVGVLENAITTICGHSFCESC 41 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 334 TCVACLEEILQPCVLQCGHIFCHQCC 257 TC +C E + P +L C C CC Sbjct: 26 TCPSCKETMNGPVLLPCLDSICRSCC 51 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 256 SNIDGRIYGHTEEHKVVIFPPSMQHMSFRYPLH 354 +N D I+G EEH PP++ ++ YP H Sbjct: 974 NNDDSEIWGVLEEHYPHNDPPTLTPATYLYPYH 1006 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = -3 Query: 334 TCVACLEEILQPCVLQ---CGHIFCHQC 260 TC CLE+ +L CG +FC QC Sbjct: 781 TCSLCLEDRTNAMLLTHDGCGRMFCRQC 808 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 337 KTCVACLEEILQPC---VLQCGHIFCHQC 260 K+C CLEE +L CGH +C C Sbjct: 260 KSCPICLEEFTPETPTRLLVCGHKYCEPC 288 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C E P +L C H FC +C Sbjct: 145 CPLCHEMFANPRLLPCLHTFCKRC 168 >SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 254 GALNSCALCRTPFTKNTVVPL 192 GALNS A+ + P T NT+ P+ Sbjct: 565 GALNSAAVYKDPITMNTIDPV 585 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 331 CVACLEEILQPCVLQCGHIFCHQC 260 C C E P VL C H FC C Sbjct: 17 CGICQETYNNPKVLPCLHSFCQNC 40 >SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) Length = 435 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 278 YILPSMLLGALNSCALCR 225 Y P M++GALNS +CR Sbjct: 151 YAYPIMMIGALNSAIICR 168 >SB_11841| Best HMM Match : Ras (HMM E-Value=0) Length = 523 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -2 Query: 143 KIVYCFLYCTYKLHIFASYGFING 72 ++ CFL C Y LH+ + +++G Sbjct: 401 RLAMCFLMCAYLLHVTGTVYYVDG 424 >SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -3 Query: 355 NEVDNEKT---CVACLEEILQPCVLQCGHIFCHQCC*AH 248 NEVD++ CV C+ + +L C H+ + C H Sbjct: 238 NEVDDDDNVLECVICMSDFRDTLILPCRHLCLCKACAFH 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,100,082 Number of Sequences: 59808 Number of extensions: 372824 Number of successful extensions: 999 Number of sequences better than 10.0: 82 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -