BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0985 (520 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharo... 26 2.9 SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c... 25 5.1 SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 25 5.1 >SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 26.2 bits (55), Expect = 2.9 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = +1 Query: 64 IYKHYSTNVKRLVFGRVALCLRVYIEIVRCYRY 162 +Y Y ++ + GR++ C +++ + YRY Sbjct: 181 VYLFYDPDMSKFSLGRISACREIWLALECGYRY 213 >SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1717 Score = 25.4 bits (53), Expect = 5.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 260 TTASFLAGLPEPLFLFTYLIKIPLLFYYGLCPYXIYL 370 TT+SFL +P+ +FL T ++P +F PY YL Sbjct: 1557 TTSSFLDKVPDGIFLKT--SRLP-IFEANKAPYNAYL 1590 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 25.4 bits (53), Expect = 5.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 317 IKIPLLFYYGLCPYXIYLHMYTIQ 388 +K+ L YY CP+ H YT Q Sbjct: 29 LKLCKLKYYNFCPFYNIQHNYTCQ 52 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,949,323 Number of Sequences: 5004 Number of extensions: 38611 Number of successful extensions: 75 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 210309424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -