BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0985 (520 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27467| Best HMM Match : ANF_receptor (HMM E-Value=6.9e-19) 27 7.0 SB_5167| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 >SB_27467| Best HMM Match : ANF_receptor (HMM E-Value=6.9e-19) Length = 922 Score = 27.5 bits (58), Expect = 7.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 161 IHVVFYHTQRNT*LRYTHVKCAN*TWSANDKQITTAS 271 I+V+F H +RNT Y AN T +N ++T S Sbjct: 757 IYVIFKHPERNT-AEYVKTIVANHTMRSNFSRVTVCS 792 >SB_5167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 70 KHYSTNVKRLVFGRVALCLRVYIEIVRCYRYTRGVLPYTKEHIIKVY 210 K + N KR R+ L +Y+ + C+RYTR VL Y K I ++ Sbjct: 24 KDFKDNGKRQSGVRICLAFGLYVVLHICHRYTR-VL-YLKRSEINLF 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,144,594 Number of Sequences: 59808 Number of extensions: 275920 Number of successful extensions: 689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1160542895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -