BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0983 (580 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.01c |nup107|SPBC582.11c|nucleoporin Nup107|Schizosacchar... 28 1.1 SPCC24B10.07 |gad8||serine/threonine protein kinase Gad8 |Schizo... 27 1.5 SPAC27E2.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 8.0 SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual 25 8.0 >SPBC428.01c |nup107|SPBC582.11c|nucleoporin Nup107|Schizosaccharomyces pombe|chr 2|||Manual Length = 794 Score = 27.9 bits (59), Expect = 1.1 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 168 SDIIQL-KLYKIIVSVSFMFVMMYIKLNVFFLRPLNLHTVYLKILT*PTK 314 S+ +QL K Y + ++ + + + Y+ V + P +HTVYLK + P + Sbjct: 510 SEQLQLAKKYSLDINHAALLAVEYVYDEVVSVSPEEVHTVYLKSIEEPVE 559 >SPCC24B10.07 |gad8||serine/threonine protein kinase Gad8 |Schizosaccharomyces pombe|chr 3|||Manual Length = 569 Score = 27.5 bits (58), Expect = 1.5 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 224 CYDVYKIKCFFFKTVESTHCLFENFNITYK 313 C+D Y+ K + + + + CL E FN+ Y+ Sbjct: 324 CFDTYRAKFYIAELLVALECLHE-FNVIYR 352 >SPAC27E2.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 76 Score = 25.0 bits (52), Expect = 8.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 203 RKCIFYVCYDVYKIKCF 253 R IF VCY +Y + CF Sbjct: 23 RGAIFLVCYPLYCVVCF 39 >SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 25.0 bits (52), Expect = 8.0 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +3 Query: 174 IIQLKLYKIIVSVSFMFVMMYIKLNVFFLRPLNLHTVYLKILT*PTKWHNFSL 332 ++ + KI+V FMF + + + + P HT YL HNFSL Sbjct: 626 LLSINQLKIVVGSLFMFTICNLLMYYLYGSPFLEHT-YLYHFGRTDHRHNFSL 677 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,951,150 Number of Sequences: 5004 Number of extensions: 35316 Number of successful extensions: 64 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -