BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0980 (644 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CAA4C Cluster: hypothetical protein TTHERM_0032... 33 7.8 >UniRef50_UPI00006CAA4C Cluster: hypothetical protein TTHERM_00329950; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00329950 - Tetrahymena thermophila SB210 Length = 316 Score = 32.7 bits (71), Expect = 7.8 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = -2 Query: 346 SPINLDNLLNGDFNYNLFCFQA*IIYTTTEAL*WTFKELNISKNPTVIKIKSNELLLCGR 167 +P DN NG NY L+ + + +T + + W N S+ PT + S ++ Sbjct: 199 NPSYTDNFSNGYHNYALYWMPSYVAWTIDDVVYW--NSTNSSQYPTPWRCSSFRIIFRTD 256 Query: 166 NRQE--FGTHYS*KNSVRLSSRVTNL 95 N Q G H++ S++ S+ T L Sbjct: 257 NGQSTASGDHFAYIQSIQYISKATYL 282 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,146,373 Number of Sequences: 1657284 Number of extensions: 7192247 Number of successful extensions: 10369 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 10148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10369 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48541014171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -