BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0980 (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0596 + 34964109-34964189,34964286-34964481,34964567-349647... 27 9.7 >03_06_0596 + 34964109-34964189,34964286-34964481,34964567-34964775, 34964868-34964970,34965053-34965227,34965617-34965883, 34965966-34966311,34966396-34966533,34966645-34966770, 34966866-34967078,34967171-34967462,34967559-34967755, 34967844-34968194,34968290-34968874 Length = 1092 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 331 LSLSVNNHFV**YDYNNGNNCVNVFLFLSVIVFDRTIIEENAFC 462 + + +NH Y Y G C+ F +++ IV+ T I A+C Sbjct: 839 IEIFFSNHCPLWYGYGGGLKCLERFSYINSIVYPWTSIPLLAYC 882 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,862,700 Number of Sequences: 37544 Number of extensions: 170749 Number of successful extensions: 174 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -