BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0973 (501 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 1.2 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 1.2 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 23 1.2 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 1.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 2.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 2.7 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 125 LVHADLDEFRDVRRHARRYAYTKTFKRYLH 36 L+H D RD+ R++A T F YL+ Sbjct: 370 LIHTDTYFLRDIIFAIRQHAVTAKFPIYLY 399 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 125 LVHADLDEFRDVRRHARRYAYTKTFKRYLH 36 L+H D RD+ R++A T F YL+ Sbjct: 372 LIHTDTYFLRDIIFAIRQHAVTAKFPIYLY 401 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 125 LVHADLDEFRDVRRHARRYAYTKTFKRYLH 36 L+H D RD+ R++A T F YL+ Sbjct: 370 LIHTDTYFLRDIIFAIRQHAITAKFPIYLY 399 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 125 LVHADLDEFRDVRRHARRYAYTKTFKRYLH 36 L+H D RD+ R++A T F YL+ Sbjct: 372 LIHTDTYFLRDIIFAIRQHAITAKFPIYLY 401 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 2.7 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 82 TPGGMLIRRPSSAIFMP 32 +PGGM++ PS+++ P Sbjct: 695 SPGGMVLPSPSTSVASP 711 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 2.7 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 82 TPGGMLIRRPSSAIFMP 32 +PGGM++ PS+++ P Sbjct: 587 SPGGMVLPSPSTSVASP 603 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,766 Number of Sequences: 336 Number of extensions: 1365 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -