BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0971 (562 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024) 27 7.9 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024) Length = 1213 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 266 LKYCEWY-RVFDVSSIKSYTFNLNLTY 343 LKYCEWY VF SI+ + + N Y Sbjct: 9 LKYCEWYMEVFGFKSIQIFNWT-NFVY 34 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 27.5 bits (58), Expect = 7.9 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = -3 Query: 227 LSVSIQ-MTFRHLHKLNSLCNVIGRISH*DICSRSTITCLINLVLYSIYLHFLYVCLVSY 51 LS+S++ + R +H L LC + RI + C I + S+ LH+L +C V Sbjct: 1782 LSLSLRYLCLRAMHYLY-LCGI--RIFALSVSLHYLYPCTICIFALSVSLHYLSLCAVCI 1838 Query: 50 LNLEIKL 30 L L + L Sbjct: 1839 LALFVSL 1845 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,372,976 Number of Sequences: 59808 Number of extensions: 218535 Number of successful extensions: 338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -