Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0971
         (562 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK130344-1|BAC85331.1|  139|Homo sapiens protein ( Homo sapiens ...    30   6.4  

>AK130344-1|BAC85331.1|  139|Homo sapiens protein ( Homo sapiens
           cDNA FLJ26834 fis, clone PRS07227. ).
          Length = 139

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = -3

Query: 128 STITCLINLVLYSIYLHFLYVCLVSYLNLEIKLVCSSQTRA 6
           ST    + +  +S YL FL+VCL   L L  +L CS    A
Sbjct: 55  STTNLTVFITCFSFYLLFLFVCLRWSLTLWPRLECSGAISA 95


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,468,424
Number of Sequences: 237096
Number of extensions: 998643
Number of successful extensions: 1342
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1324
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1341
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5646880600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)