BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0969 (511 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 24 1.1 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 24 1.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 24 1.1 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 79 VSPLNLPKKD-SLGLAWMSPLLTWVPANEK 165 V P N+ KD S+ L W+S + W N K Sbjct: 172 VVPGNMGLKDQSMALRWVSENIEWFGGNPK 201 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 79 VSPLNLPKKD-SLGLAWMSPLLTWVPANEK 165 V P N+ KD S+ L W+S + W N K Sbjct: 43 VVPGNMGLKDQSMALRWVSENIEWFGGNPK 72 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 79 VSPLNLPKKD-SLGLAWMSPLLTWVPANEK 165 V P N+ KD S+ L W+S + W N K Sbjct: 172 VVPGNMGLKDQSMALRWVSENIEWFGGNPK 201 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.130 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,182 Number of Sequences: 438 Number of extensions: 1972 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -