BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0961 (569 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71240.1 68414.m08222 expressed protein contains Pfam profile... 28 5.0 At1g42440.1 68414.m04894 expressed protein contains Pfam domain,... 27 6.7 >At1g71240.1 68414.m08222 expressed protein contains Pfam profile: PF04842 plant protein of unknown function (DUF639) Length = 824 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 346 LSCKVQSLRRLEAENKEAAEQLEEVARKERXSRXDS 453 L K QSL++++ E+++ E LEE+ E+ R D+ Sbjct: 89 LKKKSQSLKKIDLEDQQDFEDLEELLTVEQTVRSDT 124 >At1g42440.1 68414.m04894 expressed protein contains Pfam domain, PF04950: Protein of unknown function (DUF663) Length = 793 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -2 Query: 388 SRPQVAEGFALCSSVELSSLGKDSMSVSMS 299 S P+V F L +SVEL+SLG+D + + S Sbjct: 77 SAPRVIVLFPLSASVELNSLGEDVLKLLSS 106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,367,152 Number of Sequences: 28952 Number of extensions: 135339 Number of successful extensions: 311 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 311 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -