BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0954 (673 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) 101 4e-22 SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) 93 2e-19 SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_56560| Best HMM Match : GBP_C (HMM E-Value=0.065) 29 3.4 SB_59374| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 29 3.4 SB_46324| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 29 3.4 SB_44075| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) 29 3.4 SB_25615| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-10) 29 3.4 SB_19321| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 29 3.4 SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 29 3.4 SB_616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) 28 6.0 SB_21495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_18587| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 28 7.9 >SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) Length = 113 Score = 101 bits (243), Expect = 4e-22 Identities = 48/83 (57%), Positives = 53/83 (63%) Frame = +2 Query: 260 IVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXXXXXXXEYNVE 439 I+CAAY+HELPRYGVKVGLTNYAAAY TG EYNVE Sbjct: 11 IICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYTGTEEVNGDEYNVE 70 Query: 440 PVDNGPGAFRCYLDVGLARTTTG 508 +D PGAFRC+LDVGLART+TG Sbjct: 71 SIDGSPGAFRCFLDVGLARTSTG 93 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +1 Query: 508 SRVFGAMKGAVDGGLNVPH 564 +RVFGA+KGAVDGGL +PH Sbjct: 94 ARVFGALKGAVDGGLEIPH 112 >SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) Length = 328 Score = 92.7 bits (220), Expect = 2e-19 Identities = 44/83 (53%), Positives = 51/83 (61%) Frame = +2 Query: 260 IVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXXXXXXXEYNVE 439 ++ +AY+HELP +GVKVGLTNYAAAY TG EYNVE Sbjct: 106 VLASAYAHELPNFGVKVGLTNYAAAYCTGLLLARRLLTMLNLHEIYTGTDDVNGDEYNVE 165 Query: 440 PVDNGPGAFRCYLDVGLARTTTG 508 VD PGAFRC+LDVGLART+TG Sbjct: 166 SVDGSPGAFRCFLDVGLARTSTG 188 Score = 85.8 bits (203), Expect = 3e-17 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 508 SRVFGAMKGAVDGGLNVPHSIKRFPGYDAESKKFNAEVHRAHIFG 642 +RVFGA+KGAVDGGL +PHS+KRFPGYD+ESK F+AEVHR HIFG Sbjct: 189 ARVFGALKGAVDGGLEIPHSMKRFPGYDSESKDFSAEVHRNHIFG 233 Score = 80.6 bits (190), Expect = 1e-15 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 105 RRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQ 230 RR +GKTDYYARKRL+ QDKNKYNTPKYR +VR++NKD+ CQ Sbjct: 17 RRSQGKTDYYARKRLITQDKNKYNTPKYRFVVRITNKDIICQ 58 >SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1379 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 564 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 604 >SB_56560| Best HMM Match : GBP_C (HMM E-Value=0.065) Length = 557 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -3 Query: 380 QVFEAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRTQYGTFNPRVGHLACYIF 213 ++ + ++L D ++ L PS A+ +NKQ T+Y +F P G LA F Sbjct: 180 KIRQTEWMLNTDLVSFALSELEFSPSIDLFASRLNKQFTRYVSFKPDPGALAVDTF 235 >SB_59374| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 266 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 43 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 83 >SB_46324| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 266 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 43 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 83 >SB_44075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 388 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 43 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 83 >SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) Length = 1769 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -3 Query: 380 QVFEAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRTQYGTFNPRVGHLACYIF 213 ++ + ++L D ++ L PS A+ +NKQ T+Y +F P G LA F Sbjct: 340 KIRQTEWMLNTDLVSFALSELEFSPSIDLFASRLNKQFTRYVSFKPDPGALAVDTF 395 >SB_25615| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-10) Length = 475 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 365 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 405 >SB_19321| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 780 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 212 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 252 >SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1244 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 881 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 921 >SB_616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1515 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 609 ELFGFCIIARESFDGMRNIEATVNSTLHSSKDTRPVVVRAK 487 + FGF + E D MR + +T++S PV++R K Sbjct: 1159 DTFGFKVSNTEKADTMRGVLSTISSVFDPLNFAAPVIMRGK 1199 >SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) Length = 232 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 128 ISFPFTTPLEFYLVPLEVLFVLHNFNESHILNLSYK 21 ISFPFTT E Y +V F+ N LNL+ + Sbjct: 119 ISFPFTTRKEAYRQLSKVPFIAGTTNTQEALNLAQR 154 >SB_21495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1418 Score = 28.3 bits (60), Expect = 6.0 Identities = 25/90 (27%), Positives = 39/90 (43%) Frame = +3 Query: 180 PKYRLIVRLSNKDVTCQVAYSRIEGTILCALLIHMSCHVMV*RLV*QIMLQHIQLVCY*H 359 P+Y+ I++ SN + A + L L MSC + R++ Q+ L I + H Sbjct: 839 PQYKRILKYSNSSQSISTAINEFTNGCLKKLTYTMSCRLRTLRMIRQLKLTLINDL---H 895 Query: 360 EDCFKDLDLTPYTLAQQMSQVMNTMLNLST 449 + F T TL S + +L LST Sbjct: 896 QPLF-----TIITLVLPSSTFITLVLPLST 920 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 60 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVV 155 VK+K+ KR K KR+ + K+D + RK+ ++ Sbjct: 228 VKHKRKQKRKSAKHKRKHKRKSDKHKRKQTLI 259 >SB_18587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = +3 Query: 72 QYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQVAYSRIE 251 Q FK + + F+ + D K L + K KY T +YR+ + + T + R Sbjct: 14 QSFKEWTLCFEAKEMYLEDQ--NKALSGKSKYKYPTKRYRVKENIFTRPFTLKQPEVRCS 71 Query: 252 GTILCA 269 G I+C+ Sbjct: 72 GRIMCS 77 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 45 GFVKVVKNKQYFKRYQVKFKRRREGKTDY 131 GF++ +K + RY VK R R DY Sbjct: 1090 GFIEALKRRDVSSRYNVKHARFRRATNDY 1118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,124,647 Number of Sequences: 59808 Number of extensions: 434696 Number of successful extensions: 1080 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1078 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -