BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0950 (680 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 26 0.25 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 24 1.3 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 26.2 bits (55), Expect = 0.25 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 460 SLILHLILTPYLVDVEPC 513 S +LHL++TPY + +E C Sbjct: 277 SCLLHLVVTPYYLLIEVC 294 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = -3 Query: 192 HITIWIVLITHNLGKVQTKIRTNGNYCILIIISVYF 85 ++T++I+L T+N K T + C+++I +Y+ Sbjct: 233 YVTLYIIL-TNNQAKYCTTLIGLIKNCVIVIFELYY 267 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,584 Number of Sequences: 336 Number of extensions: 3904 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -