BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0943 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) 34 0.12 SB_51628| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.00061) 29 3.5 >SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) Length = 117 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 259 SHRCLSGSGCAGRGRLMLSERRPRMQTDFKSAVLQRVLR 375 SH LSG GC G+GR + E++ R +A+LQ +LR Sbjct: 58 SHLHLSGGGC-GKGRHLPKEKQSRGSPPISAALLQHILR 95 >SB_51628| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.00061) Length = 351 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Frame = +2 Query: 389 NHVVANELKALASLYLK-----RSYHYLLSAXYFNNYQTNXEGFXSSSGNYR 529 N ++ANEL + S +L+ R+ ++L Y N+++ +GF SSS +R Sbjct: 117 NAIIANELDIIGS-WLEWNEDHRNKYFLFDQLYKNSHEQTLKGFRSSSVKHR 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,703,108 Number of Sequences: 59808 Number of extensions: 365256 Number of successful extensions: 720 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -