BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0942 (672 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 29 4.5 SB_59400| Best HMM Match : UPF0160 (HMM E-Value=8.1) 29 4.5 SB_20014| Best HMM Match : EGF_CA (HMM E-Value=1.6e-18) 29 4.5 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 330 EGFHYCTTSVGTCE*KCQQTFASHVNTVSHRKPGYALA 217 E C T + CE +C TF S+ + S PG+ALA Sbjct: 578 EDIDECDTGLHKCEHQCNNTFGSYSCSCS---PGFALA 612 >SB_59400| Best HMM Match : UPF0160 (HMM E-Value=8.1) Length = 337 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -1 Query: 573 RCADNSPSPQTRVLSSEHE*SQVKSRYLFHSHSCSIHYRMDCNG 442 R + P PQT+ S+ + S+ + Y F H R++ NG Sbjct: 28 RARNPKPLPQTKYTSTSTKRSKTQEMYQFDPRPAKYHQRVNFNG 71 >SB_20014| Best HMM Match : EGF_CA (HMM E-Value=1.6e-18) Length = 184 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 330 EGFHYCTTSVGTCE*KCQQTFASHVNTVSHRKPGYALA 217 E C T + CE +C TF S+ + S PG+ALA Sbjct: 56 EDIDECDTGLHKCEHQCNNTFGSYSCSCS---PGFALA 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,973,752 Number of Sequences: 59808 Number of extensions: 403025 Number of successful extensions: 935 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -