BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0942 (672 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 25 0.66 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 6.1 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 25.0 bits (52), Expect = 0.66 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 435 ESAHCNPFGNESNKNVNEINISISLVIIRV 524 ES NP+ N ++N+I+ I+++ +RV Sbjct: 88 ESPKLNPYPNWEMNDINKIDSIINIIRVRV 117 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 83 TIVLIMK*KWIVLTTLAVPTIDGNHSPLDGPY 178 T V+IMK + + + GN PL PY Sbjct: 74 TFVIIMKFNGVPSSLNVITNKTGNGGPLLAPY 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,037 Number of Sequences: 438 Number of extensions: 3820 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -