BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0927 (431 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 24 2.7 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 3.5 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 3.5 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 3.5 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 3.5 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 3.5 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 3.5 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 3.5 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 4.6 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 4.6 DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domai... 22 8.1 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 22 8.1 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.8 bits (49), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 347 VCFCTGMILRTSSFRDGPRKKSMISNSLIGKKTSK 243 VC + RTSSF P +++ +IG +T++ Sbjct: 76 VCCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTE 110 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 339 LYRHDLKNLIIQGRAEE 289 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 339 LYRHDLKNLIIQGRAEE 289 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 339 LYRHDLKNLIIQGRAEE 289 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 339 LYRHDLKNLIIQGRAEE 289 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 339 LYRHDLKNLIIQGRAEE 289 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 339 LYRHDLKNLIIQGRAEE 289 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 339 LYRHDLKNLIIQGRAEE 289 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.0 bits (47), Expect = 4.6 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -1 Query: 128 RVHEDRHGLYLHRVIRIRRENRHVHRLEQRPPLLNDG 18 RVH H H + + R + +Q+P L+ DG Sbjct: 84 RVHIFEHAANHHHLAHLARVGLYGSSRKQKPVLMMDG 120 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 4.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 268 EFEIIDFFLGPSLNDEVLKIMPV 336 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domain polypeptide protein. Length = 122 Score = 22.2 bits (45), Expect = 8.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 372 ETCALSGTCLFLYRHDLKNLI 310 E C L C+F +R + NL+ Sbjct: 101 EKCILPEHCIFTFRSKIGNLL 121 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 22.2 bits (45), Expect = 8.1 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -3 Query: 423 TPKPNMTVVVANGN 382 +P+P+M VVANG+ Sbjct: 148 SPQPSMASVVANGD 161 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 408,301 Number of Sequences: 2352 Number of extensions: 7151 Number of successful extensions: 23 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -