BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0927 (431 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal prot... 83 1e-16 Z74041-9|CAA98523.2| 801|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z74035-5|CAA98485.2| 801|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z66523-7|CAA91416.2| 409|Caenorhabditis elegans Hypothetical pr... 28 2.5 Z48809-1|CAA88745.1| 1299|Caenorhabditis elegans Hypothetical pr... 27 5.8 AC006790-7|AAF60731.1| 547|Caenorhabditis elegans Suppressor of... 27 5.8 >U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal protein, small subunitprotein 2 protein. Length = 272 Score = 82.6 bits (195), Expect = 1e-16 Identities = 45/68 (66%), Positives = 49/68 (72%) Frame = +1 Query: 217 RKNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGD 396 +K E L LPIKEFEIID L +L DEVLKI PVQKQT AGQRTRFKAFVAIGD Sbjct: 70 KKITTLEEIYLNSLPIKEFEIIDA-LCSNLKDEVLKISPVQKQTTAGQRTRFKAFVAIGD 128 Query: 397 NNGHIWFG 420 + GH+ G Sbjct: 129 HAGHVGLG 136 Score = 44.8 bits (101), Expect = 3e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 164 EDQXEWVPVTKLGRLVREGKIDKLESIYL 250 E + EW PVTKLGRLV+E KI LE IYL Sbjct: 52 EKETEWTPVTKLGRLVKEKKITTLEEIYL 80 >Z74041-9|CAA98523.2| 801|Caenorhabditis elegans Hypothetical protein F47G9.3 protein. Length = 801 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 384 NKCLETCALSGTCLFLYR-HDLKNLIIQGR 298 ++CLE C +S C F Y+ D+ N +I R Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRR 315 >Z74035-5|CAA98485.2| 801|Caenorhabditis elegans Hypothetical protein F47G9.3 protein. Length = 801 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 384 NKCLETCALSGTCLFLYR-HDLKNLIIQGR 298 ++CLE C +S C F Y+ D+ N +I R Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRR 315 >Z66523-7|CAA91416.2| 409|Caenorhabditis elegans Hypothetical protein M05D6.7 protein. Length = 409 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 194 KLGRLVREGKIDKLESIYLFFYQSKNSRSL 283 K+G ++REGK++K S Y+ NS+SL Sbjct: 107 KIGNIIREGKVEKNVSNDNKIYELWNSKSL 136 >Z48809-1|CAA88745.1| 1299|Caenorhabditis elegans Hypothetical protein T01E8.3 protein. Length = 1299 Score = 27.1 bits (57), Expect = 5.8 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 262 LVKKQVNALEFVDFSFANKTAEFGDRN-PLXLVF 164 L + ALEF++ F A FGDRN P VF Sbjct: 245 LASNRTRALEFLNRYFQEDQAYFGDRNEPSMTVF 278 >AC006790-7|AAF60731.1| 547|Caenorhabditis elegans Suppressor of mec and unc defectsprotein 2 protein. Length = 547 Score = 27.1 bits (57), Expect = 5.8 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -1 Query: 158 RAHDHGRDHDRVHEDRHGLYLHRVIRIRRENRHVHRLEQR 39 R+ D RD DR + DR Y + RRE R +QR Sbjct: 354 RSRDRDRDRDRDNRDR---YFEKSANSRREEEQNRREQQR 390 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,055,022 Number of Sequences: 27780 Number of extensions: 169218 Number of successful extensions: 571 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 724655464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -