BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0920 (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 26 0.95 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 6.7 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 6.7 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 6.7 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 8.8 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 26.2 bits (55), Expect = 0.95 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 585 PVSVLSTPPHRLELSLACSLNDLE 514 P V +TP H+ S +CSL+ LE Sbjct: 115 PAEVPTTPEHKSAASSSCSLSTLE 138 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.4 bits (48), Expect = 6.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 271 TLKEASWQLKGEVDASKRPQNSLLQEVVDFD 363 T+ E + QL+ EV+ +R SLL V+D D Sbjct: 343 TVDEKNKQLQ-EVEMRERSSKSLLANVLDID 372 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 281 SFKVFSSSRECVVLVFAGVA 222 + K+ SSS E ++ +F GVA Sbjct: 528 ALKMLSSSAETIIFMFLGVA 547 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.4 bits (48), Expect = 6.7 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +2 Query: 194 TIEEKQSEFEQRQQRLKQHIHD*RKRL*KKPLGNSKVKWMHRNVLKTH 337 TI+ ++ +Q++ LK+ D + P +V W V +TH Sbjct: 799 TIQRLTAKLKQQEMELKRMHMDVASLTQQMPRLKEQVDWQAERVARTH 846 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.0 bits (47), Expect = 8.8 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = +2 Query: 200 EEKQSEFEQRQQRLKQH 250 ++KQ + ++RQQ+ +QH Sbjct: 267 QQKQQQLQRRQQQQQQH 283 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 452,771 Number of Sequences: 2352 Number of extensions: 6079 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -