BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0920 (675 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL033514-7|CAA22114.1| 648|Caenorhabditis elegans Hypothetical ... 76 2e-14 >AL033514-7|CAA22114.1| 648|Caenorhabditis elegans Hypothetical protein Y75B8A.7 protein. Length = 648 Score = 76.2 bits (179), Expect = 2e-14 Identities = 35/67 (52%), Positives = 49/67 (73%) Frame = +1 Query: 253 SRLEEKTLKEASWQLKGEVDASKRPQNSLLQEVVDFDLTTRPAPIITEQTTVSLEDIIKR 432 ++LEE+ L SW+L GEV A +R QN+LL++ VDFD + AP +TE+ T LE +IK+ Sbjct: 348 AKLEEENLAPKSWELSGEVAADQRDQNTLLEKHVDFDHGAKRAPEVTEEFTDRLESLIKQ 407 Query: 433 RIKDKAW 453 RI+DKAW Sbjct: 408 RIRDKAW 414 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,139,533 Number of Sequences: 27780 Number of extensions: 147389 Number of successful extensions: 392 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -