BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0920 (675 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66540.1 68418.m08389 expressed protein ; supported by full-L... 70 2e-12 >At5g66540.1 68418.m08389 expressed protein ; supported by full-Length cDNA gi:12057175 from [Arabidopsis thaliana] Length = 524 Score = 69.7 bits (163), Expect = 2e-12 Identities = 30/61 (49%), Positives = 43/61 (70%) Frame = +1 Query: 256 RLEEKTLKEASWQLKGEVDASKRPQNSLLQEVVDFDLTTRPAPIITEQTTVSLEDIIKRR 435 ++E+ L W ++GE+ A+KRP NS L+ +DF+ RPAP+ITE+ T SLED+IK R Sbjct: 295 QMEKANLDPKHWTMQGEITAAKRPMNSALEVDLDFEHNARPAPVITEEVTASLEDLIKSR 354 Query: 436 I 438 I Sbjct: 355 I 355 Score = 33.1 bits (72), Expect = 0.17 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +3 Query: 516 LDHSKSKLSLAQVYEAEYLKQKQAA 590 LD SKSK LA+VYEAEY ++ A Sbjct: 380 LDESKSKKGLAEVYEAEYFQKANPA 404 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,653,414 Number of Sequences: 28952 Number of extensions: 139587 Number of successful extensions: 327 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -