BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0917 (674 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z80220-3|CAB02306.1| 601|Caenorhabditis elegans Hypothetical pr... 28 5.3 AC024882-5|AAF60932.1| 666|Caenorhabditis elegans Hypothetical ... 28 5.3 >Z80220-3|CAB02306.1| 601|Caenorhabditis elegans Hypothetical protein T08G11.3 protein. Length = 601 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 350 YQLPVLXXXYCTHQHIQTRFSLHHVF 273 +Q P C HQH ++RFS H++ Sbjct: 17 FQEPSTRRALCFHQHCRSRFSFLHIY 42 >AC024882-5|AAF60932.1| 666|Caenorhabditis elegans Hypothetical protein Y9C9A.8 protein. Length = 666 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -3 Query: 366 YYYTIVPITSTILLVLYTPTYTNQILIASCIYLNTFV 256 ++Y++ P+ + + Y Y N+ + + CI+ N FV Sbjct: 211 FFYSMYPMVDPLPTIYYVDEYRNEFM-SECIFNNEFV 246 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,526,054 Number of Sequences: 27780 Number of extensions: 289710 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -