BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0916 (676 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35760.1 68417.m05076 expressed protein 30 1.6 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 29 2.1 At1g63260.1 68414.m07152 senescence-associated family protein si... 29 2.1 At3g13790.1 68416.m01742 beta-fructosidase (BFRUCT1) / beta-fruc... 29 2.8 At4g11670.1 68417.m01865 expressed protein contains Pfam PF05664... 29 3.8 At2g30880.1 68415.m03763 pleckstrin homology (PH) domain-contain... 29 3.8 At1g09050.1 68414.m01009 expressed protein 28 5.0 At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]... 28 6.6 At1g53060.1 68414.m06008 legume lectin family protein 28 6.6 At5g50380.1 68418.m06240 exocyst subunit EXO70 family protein co... 27 8.7 At5g35370.1 68418.m04204 lectin protein kinase family protein co... 27 8.7 At3g53640.1 68416.m05925 protein kinase family protein contains ... 27 8.7 At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fruc... 27 8.7 At3g06710.1 68416.m00794 expressed protein 27 8.7 At2g15640.1 68415.m01791 F-box family protein contains Pfam PF00... 27 8.7 At1g29740.1 68414.m03636 leucine-rich repeat family protein / pr... 27 8.7 >At4g35760.1 68417.m05076 expressed protein Length = 376 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 283 EVSPPVVTTEPRSEKHEKGDKCVARIVAGSKPDGYDSGHESTPRTGKHSPAATSRRAES 459 EVSPP VT+ PR + E D+ I ++G +S P S ++TS + S Sbjct: 19 EVSPPSVTSYPR--RFEVSDRRFPAIPIKCSSSEPENGEDSAPSLSSSSSSSTSEVSTS 75 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 29.5 bits (63), Expect = 2.1 Identities = 27/80 (33%), Positives = 34/80 (42%) Frame = +2 Query: 416 PENTVRPPPRDEPNPATTLFQETQTRHPWTHPD*TSRSRTGAR*KTHHSEIQTAQPIVHS 595 P TV PPP P PA T T T P P TS + A + S+ TA P + Sbjct: 28 PTTTVTPPPVATPPPAATP-APTTTPPPAVSPAPTSSPPSSA--PSPSSDAPTASP--PA 82 Query: 596 ARG*GIVHVQIRLTPIQKSA 655 G G+ ++ TP SA Sbjct: 83 PEGPGVSPGELAPTPSDASA 102 >At1g63260.1 68414.m07152 senescence-associated family protein similar to senescence-associated protein 5 [Hemerocallis hybrid cultivar] gi|3551954|gb|AAC34855 Length = 284 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 175 CDSCISYVVASVPFEWPVAVVVRSIWFV--ISPTYSTPWPGHGSFATITNLI 26 CDSC + V + EW + + + FV IS ST + SF + L+ Sbjct: 214 CDSCKAGVAQYMKTEWRLVAIFNVVLFVVLISSLLSTRFDSEQSFGLLNGLV 265 >At3g13790.1 68416.m01742 beta-fructosidase (BFRUCT1) / beta-fructofuranosidase / cell wall invertase identical to beta-fructofuranosidase GI:402740 from [Arabidopsis thaliana] Length = 584 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 128 PFERYRGNDITDARIASLRHPDGASDPNLREEKRIPGN 241 P Y G D + ++ ++ P SDP LRE K+ P N Sbjct: 137 PVILYTGIDPKNQQVQNIAEPKNLSDPYLREWKKSPLN 174 >At4g11670.1 68417.m01865 expressed protein contains Pfam PF05664: Protein of unknown function (DUF810) Length = 985 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = -1 Query: 457 IRLVSRWRPDCVFRFSELIHARYRIR----PVSIRQLFWLRIYRPFHVSRIEVRLSQLEG 290 + + S+W P+C+ + L+H Y R P+S++Q I F + IE +SQL G Sbjct: 543 VPVFSKWLPECMMISAMLLHRFYGERLEWEPLSVQQRHAASIVEIFRI--IEETVSQLFG 600 >At2g30880.1 68415.m03763 pleckstrin homology (PH) domain-containing protein contains Pfam profile PF00169: PH domain Length = 504 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Frame = +2 Query: 26 DKICDSCKRTMSRPGSAVGGAYHEPDGSHNDCYGPFERYRGNDI--TDARIASLRHPDGA 199 DK C S RT S PG V H + + P NDI T+AR++ +R Sbjct: 414 DKACLSISRTASIPGENV---VHMSEEQVVNAQPPVGENEWNDIQATEARVSDVREISAE 470 Query: 200 SDPNLREEKRIP 235 ++ + R IP Sbjct: 471 TERDRRNSLDIP 482 >At1g09050.1 68414.m01009 expressed protein Length = 916 Score = 28.3 bits (60), Expect = 5.0 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 2/88 (2%) Frame = +1 Query: 220 RKTNTRKRGVYFKELKS--NLHLEVSPPVVTTEPRSEKHEKGDKCVARIVAGSKPDGYDS 393 R+ +TRKR + + L++ + L TT+P KHE K A ++ D Sbjct: 787 RRQSTRKRPLTTRALEALESDFLITKRMKSTTKPEPRKHESSTKKKRSAKACNRNGSADL 846 Query: 394 GHESTPRTGKHSPAATSRRAESGYDSVP 477 H R+ + TS+ + DS P Sbjct: 847 EHRGEDRSSFTKKSPTSKPLDQIEDSKP 874 >At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]-like (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to both RPP1 Ws-A and RPP1 Ws-C Length = 872 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -3 Query: 332 SCFSDRGSVVTTGGDTSKCKLDFSSLKYTPRFRVFVFLL 216 +CF+ R T GD+ K KL SSL T RF+ + L+ Sbjct: 669 ACFNHRA----TSGDSLKIKLKESSLPTTLRFKACIMLV 703 >At1g53060.1 68414.m06008 legume lectin family protein Length = 242 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 106 SIWFVISPTYSTPWPGHG-SFATITN 32 S +FVISP P PGHG +F + N Sbjct: 59 SFYFVISPRPKNPNPGHGLAFIIVPN 84 >At5g50380.1 68418.m06240 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 683 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +2 Query: 41 SCKRTMSRPGSAVGGAYHEPDGSHNDCYGPFERYRGNDITDARIASLRHPDGASDPNLRE 220 S R S GS+ G + +++ ER+RG + + + L+ DP LRE Sbjct: 560 SALRDESMGGSSSGSPSYGQRSNNSSKMALKERFRGFNASFEELYRLQTAWKVPDPQLRE 619 Query: 221 EKRI 232 E RI Sbjct: 620 ELRI 623 >At5g35370.1 68418.m04204 lectin protein kinase family protein contains Pfam domains, PF01453: Lectin (probable mannose binding) and PF00069: Protein kinase domain Length = 870 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 497 DDASESLGTES*PDSARLEVAAGLCFPVLGVDSCPLS 387 D+ASE+ S PD R++ G+C PV S P+S Sbjct: 300 DNASENQSC-SCPDEMRMDAGKGVCVPVSQSLSLPVS 335 >At3g53640.1 68416.m05925 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 642 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 8 RAYRPSDKICDSCKRTMSRPGSAVGGAYHEPDGSHNDCYGPFERYRGND 154 R+Y PSD++ S KR + + DG+ + Y PF GND Sbjct: 16 RSYSPSDEVVKSSKRHKHHHHKHRHSHHLDEDGNEKNVY-PFLGNPGND 63 >At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fructofuranosidase, putative / cell wall invertase, putative similar to beta-fructofuranosidase GI:402740 from [Arabidopsis thaliana] Length = 569 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 128 PFERYRGNDITDARIASLRHPDGASDPNLREEKRIPGNGACT 253 P Y GND + ++ +L P +DP LR + P N T Sbjct: 127 PVILYTGNDRYNRQVQNLVKPKNLTDPYLRHWTKSPENPLVT 168 >At3g06710.1 68416.m00794 expressed protein Length = 302 Score = 27.5 bits (58), Expect = 8.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 139 PFEWPVAVVVRSIWFVISPTY 77 PF WP + + ++WF+ TY Sbjct: 264 PFIWPALLALIAVWFMAKQTY 284 >At2g15640.1 68415.m01791 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 426 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 305 VTTGGDTSKCKLDFSSLKYTPRFRVFVF 222 V+ G T+ ++ FS LKYTP+ +VF Sbjct: 338 VSIAGGTASGEIVFSMLKYTPKQPFYVF 365 >At1g29740.1 68414.m03636 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1049 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -1 Query: 172 DSCISYVVASVPFEWPVAVVVRSIWFVISPTYSTPWPGHGSFATITNL 29 D C +Y+ S+P EW ++SI + G G F +T L Sbjct: 128 DLCRNYLYGSIPMEWASLPYLKSISVCANRLTGDIPKGLGKFINLTQL 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,282,456 Number of Sequences: 28952 Number of extensions: 371848 Number of successful extensions: 1267 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -