SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0915
         (674 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611...    30   1.9  

>12_02_0408 +
           18659494-18660362,18660472-18660634,18660976-18661139,
           18661253-18661511,18661605-18661712
          Length = 520

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 12/42 (28%), Positives = 25/42 (59%)
 Frame = +2

Query: 239 LIKVSINQHHNLISLHIIFQMNIKENVRLGLKVLLPGFKKII 364
           L+++S+N H       +I  +  +E ++L ++ L PGF ++I
Sbjct: 281 LVRISLNVHGTRAVQKLIESLRTREEIQLVVQALRPGFLELI 322


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,456,597
Number of Sequences: 37544
Number of extensions: 211706
Number of successful extensions: 348
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 340
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 348
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1714968940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -