BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0915 (674 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 30 1.9 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +2 Query: 239 LIKVSINQHHNLISLHIIFQMNIKENVRLGLKVLLPGFKKII 364 L+++S+N H +I + +E ++L ++ L PGF ++I Sbjct: 281 LVRISLNVHGTRAVQKLIESLRTREEIQLVVQALRPGFLELI 322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,456,597 Number of Sequences: 37544 Number of extensions: 211706 Number of successful extensions: 348 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -