BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0914 (659 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55420.1 68414.m06339 DC1 domain-containing protein contains ... 29 3.6 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 28 4.8 At5g17440.1 68418.m02046 LUC7 N_terminus domain-containing prote... 28 6.3 At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing prote... 27 8.4 At1g55440.1 68414.m06341 DC1 domain-containing protein contains ... 27 8.4 >At1g55420.1 68414.m06339 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 725 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 142 VNIXYFNFNKKKCSYLYSHQCH-RNNLWSWKLFHSPPVEPD 23 VN ++ NK+ C Y +C RN++W K P EPD Sbjct: 326 VNYGQYSCNKE-CHYAVHSKCATRNDVWDGKDLDGVPEEPD 365 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 142 VNIXYFNFN-KKKCSYLYSHQCH-RNNLWSWKLFHSPPVEPD 23 V++ Y ++ K+C Y +C RN++W K P EPD Sbjct: 285 VDVNYGQYSCDKECHYAVHSKCATRNDVWDGKDLDGVPEEPD 326 >At5g17440.1 68418.m02046 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: Protein of unknown function, DUF259 Length = 404 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 1 GECPKIHDLALRADYEIA 54 G CPK+H L LR +Y+ A Sbjct: 54 GPCPKVHSLQLRKEYKDA 71 >At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: LUC7 N_terminus Length = 402 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 1 GECPKIHDLALRADYEIA 54 G CPK+H L LR +Y A Sbjct: 54 GPCPKVHSLQLRKEYREA 71 >At1g55440.1 68414.m06341 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 653 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 142 VNIXYFNFNK-KKCSY-LYSHQCHRNNLWSWKLFHSPPVEPD 23 V++ Y ++ K C Y ++SH RN++W + P EPD Sbjct: 277 VDVNYGQYSCIKGCHYAVHSHCATRNDVWDGEDLEGVPEEPD 318 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,006,877 Number of Sequences: 28952 Number of extensions: 147118 Number of successful extensions: 274 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 274 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -